Məlumat

Ubuntu 14.04-də (1.2.1) üzrə clustalo çıxışı

Ubuntu 14.04-də (1.2.1) üzrə clustalo çıxışı


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Aşağıdakı əmrdən istifadə edərək Ubuntu terminalında clustalo istifadə edərək aşağıdakı 8 ardıcıllığı uyğunlaşdırmağa çalışıram. Amma düzgün nəticə əldə edə bilmirəm.

clustalo -i sequence.fasta -o output.clu

Mənim giriş faylımdırardıcıllıq.sürətliBLAST-dan yüklədiyim 8 ardıcıllıqla

Mənim çıxış faylımoutput.clu

Ümid etdiyim nəticə outputOnline.clustal

Bəziləri mənə sualda bu cür məlumatların necə paylaşılacağını söyləyə bilsələr, çox sevinərəm, çünki mənim etdiyim üsul uyğun görünmür.


Siz sadəcə olaraq çıxış formatını təyin etməlisinizoutfmtbayraq.

clustalo -i sequence.fasta -o output.clu -outfmt=clu

istədiyiniz nəticəni verməlidir.


Məlumatları necə paylaşmaq olar?

İnsanların kopyalayıb yapışdıra biləcəyi qısaldılmış nümunədən istifadə etməyə çalışın, daha uzun məlumat üçün http://pastebin.com/ kimi bir şeydən istifadə edə bilərsiniz, lakin URL-nin vaxtı bitə bilər.

gi|1709777|sp|P51780.1|PRIO_TRIVU MGKIQLGYWILVLFIVTWSDLGLCKKPKPRPGGGWNSGGSNRYPGQPGSPGGNRYPGWGWGHPQGGGTNWGQPHPGGSNWGQPHPGGSSWNKPKG

gi|1709773|sp|P52114.1|PRIO_MUSPF MVKSHIGSWLLVLFVATWSDIGFCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGWGQPHGGGWGQPHGGGWGQPHGGGWGPS

gi|1709774|sp|P49927.1|PRIO_PIG MVKSHIGGWILVLFVAAWSDIGLCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGWGQPHGGGWGQPHGGGWGQPHGGGWGPSGPPQ


&ldquoGiriş/çıxış xətası&rdquo kataloqa daxil olarkən

Mən çıxarıla bilən sabit diskdəki kataloqun məzmununu siyahıya almaq və silmək istəyirəm. Ancaq "Giriş/çıxış xətası" ilə qarşılaşdım:

Maraqlıdır, problem nədir?

Kataloq şəklini və onun bütün məzmununu necə bərpa edə və ya silə bilərəm?

Mənim əməliyyat sistemim Ubuntu 12.04-dür və çıxarıla bilən sabit diskdə ntfs fayl sistemi var. Çıxarıla bilən sabit diskdə şəkil olmayan və ya daxili şəkil olmayan digər kataloqlar yaxşı işləyir.

Kataloqun məzmununu sadalamağa çalışdıqdan sonra dmesg çıxışının son hissəsi:


Stdout-u birdən çox əmrə necə göndərə bilərəm?

Bəzi əmrlər var ki, daxil olanları süzgəcdən keçirən və ya hərəkət edən və sonra onu çıxış kimi ötürən, məncə, adətən, stdout-a - lakin bəzi əmrlər sadəcə olaraq stdin-i götürüb, onunla nə edirlərsə etsinlər və heç bir nəticə çıxarmırlar.

Mən OS X ilə ən çox tanışam və buna görə də dərhal ağlıma gələn iki şey var pbcopy və pbpaste - bu sistem mübadilə buferinə daxil olmaq üçün vasitədir.

Hər halda, mən bilirəm ki, əgər mən stdout-u götürmək və həm stdout-a, həm də fayla getmək üçün çıxışı tüpürmək istəsəm, tee əmrindən istifadə edə bilərəm. Və xargs haqqında bir az bilirəm, amma axtardığımı düşünmürəm.

Mən bilmək istəyirəm ki, iki (və ya daha çox) əmr arasında getmək üçün stdout-u necə bölmək olar. Misal üçün:

Yəqin ki, bundan daha yaxşı bir nümunə var, amma mən, həqiqətən, stdout-u ötürməyən bir əmrə necə göndərə biləcəyimi bilməklə maraqlanıram və stdout-un "səssiz" olmasından qoruyuram - mən onu necə pişik etmək barədə soruşmuram. faylı və onun bir hissəsini grep və panoya kopyalayın - xüsusi əmrlər o qədər də vacib deyil.

Həmçinin - Mən bunu bir fayla və stdout-a necə göndərəcəyimi soruşmuram - bu "dublikat" sual ola bilər (üzr istəyirik), lakin mən bir az axtardım və yalnız stdout və stdout arasında necə bölmək barədə soruşan oxşar sualları tapa bildim. fayl - və bu sualların cavabları mənim üçün işləməyəcəyini düşünmürəm.

Nəhayət, siz soruşa bilərsiniz "niyə pbcopy-ni boru zəncirindəki son şey etmirsiniz?" və mənim cavabım 1) ondan istifadə etmək istəsəm və hələ də çıxışı konsolda görsəm nə olar? 2) girişi emal etdikdən sonra stdout çıxarmayan iki əmrdən istifadə etmək istəsəm nə etməliyəm?

Oh, və daha bir şey - mən tişörtdən və adlandırılmış borudan ( mkfifo ) istifadə edə biləcəyimi başa düşürəm, lakin bunun əvvəlcədən quraşdırma olmadan qısa şəkildə edilə biləcəyinə ümid edirdim :)


PL2303/PL2303X USB-Serial sürücü

Avadanlığı Linux hostuna qoşmaq üçün PL2303X çipli USB-Serial adapterim var. Cihaz lsusb vasitəsilə qoşulmuş görünür, lakin mən məlumat göndərə və qəbul edə bilmirəm. Mən əmrlər göndərməyə cəhd edərkən moserial və macun istifadə edərək məlumat göndərməyə/qəbul etməyə çalışdım, heç bir cavab məlumatı qaytarılmır və dmesg və ya /var/log/syslog-da heç bir dəyişiklik görmədim.

Eyni USB-Serial adapter Windows-da Windows 10 ilə eyni Dell noutbuk modelinə qoşulur və işləyir, o, əmrləri qəbul edə və aşağıdakı port parametrləri ilə konfiqurasiya edilmiş məlumatları qaytara bilər.

Aşağıdakı port parametrlərini istifadə etmək istərdim, baxmayaraq ki, mən aşağıdakıların variasiyalarını sınamışam, lakin heç bir nəticə verməmişəm (məsələn, heç bir paritet yoxdur, müxtəlif ötürmə sürətləri, aparat/proqram təminatı ilə əl sıxışdırmaq və s.):

Windows yuxarıdakı parametrləri dəyişdirməklə də işləyir (yəni paritet yoxdur, 7 məlumat biti, aşağı/daha yüksək ötürmə sürəti və s.).

Mən əmrlər göndərə və cihazın Windows istifadə edərək işləməsinə bənzər məlumatları qəbul edə bilməliyəm, tercihen yuxarıdakı port parametrləri ilə.

Bunu necə düzəltmək və ya debug etmək barədə hər hansı bir fikir var? Mən bunu qiymətləndirirəm.

lsusb çıxışı cihazı Avtobus 001 Cihaz 016 olaraq müəyyən edir: ID 067b:2303 Prolific Technology, Inc. PL2303 Serial Port

İnanıram ki, adapterdə PL2303 əvəzinə PL2303X çipi var (mənbə: PL2303 & Pl2303x usb serial cihazı).

Mən /var/log/syslog-da "MTP cihazı deyil" və "idarə olunmayan "bağlama"" mesajlarını görürəm:

Mən Linux nüvə modulunda Prolific PL-2303X USB seriyalı adapter üçün köhnə yamaq tapdım, baxmayaraq ki, əsas ləpə ağacında 2.6.8-dən başlayaraq PL-2303X dəstəyinin olduğu qeyd olunur.

Cihazı birləşdirdikdən sonra dmesg:

Aşağıda fasilə = -19 mesajının göndərilməsi xətası ilə də tanış oldum, lakin onu təkrarlamaqda çətinlik çəkirəm:


Mən bu sualı stackoverflow-da gördüm, lakin cavabların heç birini bəyənmədim və bu, həqiqətən də burada U&L-də olmalı olan sualdır.

Əsasən fayl sistemindəki hər bir fayl üçün bir inode istifadə olunur. Beləliklə, inodelərin tükənməsi, ümumiyyətlə, ətrafınızda çoxlu kiçik faylların olması deməkdir. Beləliklə, həqiqətən sual yaranır: "hansı kataloqda çoxlu sayda fayl var?"

Bu halda, maraqlandığımız fayl sistemi kök fayl sistemidir / , ona görə də aşağıdakı əmrdən istifadə edə bilərik:

Bu, həmin qovluqdakı faylların (və alt kataloqların) sayı ilə prefiksli fayl sistemindəki hər bir kataloqun siyahısını atacaq. Beləliklə, ən çox sayda faylı olan qovluq aşağıda olacaq.

Mənim vəziyyətimdə bu, aşağıdakıları ortaya çıxarır:

Beləliklə, əsasən /var/spool/postfix/maildrop bütün inodeləri istehlak edir.

*Qeyd edək ki, bu cavabda ağlıma gələn üç xəbərdarlıq var. Yolda yeni sətirlərlə heç nəyi düzgün idarə etmir. Bilirəm ki, fayl sistemimdə yeni sətirləri olan fayl yoxdur və bu, yalnız insan istehlakı üçün istifadə edildiyi üçün potensial problemi həll etməyə dəyməz və hər zaman -i ilə əvəz edə və çeşidləmə və uniq üçün -z seçimlərindən istifadə edə bilərsiniz. yuxarıdakı əmrlər aşağıdakı kimidir:

İstəyə görə, ən çox istifadə olunan 10 inodu əldə etmək üçün əmrə head -zn10 əlavə edə bilərsiniz.

O, həmçinin faylların çoxlu sayda kataloqlar arasında yayılmasını idarə etmir. Bu mümkün deyil, ona görə də riski məqbul hesab edirəm. O, həmçinin eyni fayla (yalnız bir inode istifadə etməklə) bir neçə dəfə sərt keçidləri sayacaq. Yenə də yalan pozitivlər vermək ehtimalı azdır*

Stackoverflow cavabındakı cavabların heç birini bəyənməməyimin əsas səbəbi onların hamısının fayl sistemi sərhədlərini keçməsidir. Mənim problemim kök fayl sistemində olduğundan, bu o deməkdir ki, o, hər bir quraşdırılmış fayl sistemini keçəcək. Tap əmrlərinə -xdev atmaq düzgün işləməyəcək.
Məsələn, ən çox səs toplayan cavab budur:

Bunun əvəzinə bunu dəyişdirsək

Baxmayaraq ki, /mnt/foo montajdır, o, həm də kök fayl sistemində bir kataloqdur, ona görə də find-da görünəcək. -xdev -type d , və sonra o, ls -a $i -ə ötürüləcək, bu da dağı dala bilər.

Cavabımdakı tapıntı əvəzinə montajdakı hər bir faylın kataloqunu sadalayır. Beləliklə, əsasən fayl strukturu ilə:


Nəticələr

Nanopor sekvensiyası həm ardıcıllıq texnologiyası, həm də məlumatların təhlili baxımından sürətlə inkişaf edən bir texnologiyadır. SV analizi üçün uzun müddət oxunan ardıcıllıq məlumatlarından istifadə etmək üçün bir neçə yeni hizalayıcılar və SV zəng edənlər hazırlanmışdır. Bundan əlavə, SV-nin identifikasiyası üçün montaj əsaslı yanaşmalar da istifadə edilə bilər. Biz xəritəçilərin və SV zəng edənlərin qiymətləndirilməsi üçün iş axını yaratdıq. SV zəng edənlərin performansının SV növləri arasında fərqləndiyini aşkar etdik. Buna görə də, tövsiyələrimiz xüsusi tətbiqlərə uyğunlaşdırılmışdır. İlkin təhlil üçün biz minimap2 və Sniffles-ı tövsiyə edirik ki, onların yüksək sürəti və həm əlavələr, həm də silinmələri çağıran nisbətən balanslaşdırılmış performansı var. Daha ətraflı təhlil üçün çoxlu alətlər işlətməyi və ən yaxşı performans üçün onların nəticələrini birləşdirməyi tövsiyə edirik. Yüksək keyfiyyətli həqiqi dəst müəyyən edilə bildikdə, zəng dəstini daha da təkmilləşdirmək üçün burada təklif etdiyimiz kimi maşın öyrənmə yanaşmasından istifadə edilə bilər. Nanoporələrin ardıcıllığı üçün əksər analiz vasitələri bu yaxınlarda işlənib hazırlanmışdır və həm dəqiqlik, həm də həssaslıq təkmilləşdirilə bilər. Texnologiya yaxşılaşdıqca və istifadəçi bazası böyüdükcə ONT və nanopor sekvensiya cəmiyyətindən resursların yığılmasını gözləyirik. Daha çox məlumat yaradıldıqca, alətin performansını daha dəqiq qiymətləndirmək və gələcək alət inkişafını asanlaşdırmaq üçün daha yaxşı etalon çağırış dəstləri mövcud olacaq.


3 Cavab 3

Sizdə olan çox iş parçacıqlı proqramdır ki, orada bir başlıq nüvə xətasına dəyib.

Səhvlərin bəzi təhlili

Siz ID 1160 ilə proses mongodunu bağlamağa çalışmısınız. ID 1160 ilə əsas mövzu zombi vəziyyətindədir və prosesdəki digər mövzuların ölməsini gözləyir.

1247 ID-li ftdc ipi, sonsuz dövrə ilə bitən madvise sistem çağırışına zəng edərkən bir nöqtədə nüvə səhvinə düşdü.

Nüvənin ilişib qalmış ipi görən və nüvə jurnalına stacktrace daxil edən nəzarətçi iti var. Stacktrace mövzunun adını ehtiva edirdi. Bu halda ipin adı və prosesi fərqli olduğundan ikisi arasındakı əlaqə stacktrace-dən dərhal aydın deyildi.

Siz hətta ilk növbədə mongod-u bağlamağa cəhd etməmişdən əvvəl bu mövzu çox güman ki, bu vəziyyətdə qalıb.

Daha sonra echo l > /proc/sysrq-trigger-i işə saldığınız zaman yapışmış ip üçün stacktrace yenidən daxil oldu. İki stacktrace tamamilə eynidir, ona görə də o, çox yaxşı bir şəkildə eyni yerdə ilişib qalmışdır.

Səhv haqqında məlumat verilir

Etməli olduğunuz şey kernelə qarşı səhv faylı verməkdir. Nəzarətçinin ipin ilişib qaldığını ilk aşkar etdiyi vaxtdan etibarən jurnal çıxışını daxil etməyi unutmayın.

Sistemin yenidən işə salınması

Bu sistemi yenidən yaxşı vəziyyətə gətirmək üçün yenidən başlatmalı olacaqsınız. Və təmiz bağlanmanın mümkün olmama riski var.

Təmiz söndürməyə cəhd etsəniz, maşını uzaqdan enerji dövriyyəsinə çevirmək üçün bir yolunuz olmadığı təqdirdə onu sıfırlamaq üçün ona fiziki girişə ehtiyacınız ola bilər.

Siz echo b > /proc/sysrq-trigger ilə təmiz olmayan yenidən işə salmağa cəhd edə bilərsiniz ki, bu da təxminən maşından gücün çəkilməsi qədər dağıdıcıdır. Bu, təmiz bağlanma cəhdinin ilişib qaldığı və siz artıq maşına ssh edə bilməyəcəyiniz ssenaridən qaçacaq.

Nə etsəniz də, yükləmə zamanı fayl sistemi yoxlamasına ehtiyacınız olacaq. Beləliklə, maşını hər hansı bir şəkildə bağlamağa cəhd etməzdən əvvəl, vacib məlumatları diskə yazan xidmətləri dayandırmalı və sinxronizasiya əmrini işlətməlisiniz.

Sinxronizasiya əmrinin ilişib qalması riski var. Bununla belə, ilişib qalmış prosesin stacktrace fayl sistemi və ya I/O ilə bağlı heç bir şey ehtiva etmədiyi üçün mən bu riski kiçik hesab edirəm.

Fayl sistemi uyğunsuzluqlarına görə onu yükləmə zamanı əldə etmək üçün maşına fiziki girişə ehtiyacınız olacaq risk də var. Bununla belə, bunun ehtimalı təmiz bağlanma cəhdinin ilişib qalması ehtimalından azdır.


Ubuntu 14.04-də (1.2.1) clustalo çıxışı - Biologiya

phylo-node: Node.js istifadə edən Molekulyar Filogenetik Alətlər dəsti

Modulu tələb edin, məsələn:

icra sənədlərinin $PATH-də olduğundan əmin olun

Ardıcıllıq Qoşulma Nömrələri boşluqla ayrılmış əmr satırından toplanır (vergül deyil)

Node ardıcıllığı fastA formatında yükləmək üçün NCBI e-utilitlərindən istifadə edir:

Əsas istifadə: node app.js giriş faylı [boşluqdan ayrılmış qoşulma nömrələrinin siyahısı]

ASN.1 formatında Sequence məlumat əldə edin

Ardıcıllıq Qoşulma Nömrələri genbank_json metodundan istifadə etməklə yuxarıda göstərilən fastA ardıcıllığına uyğun olaraq toplanır:

Əsas istifadə: node app.js giriş faylı [boşluqdan ayrılmış qoşulma nömrələrinin siyahısı]

İcra edilə bilən faylları yükləyin:

Əsas istifadə: node app.js URL

Qeyd: PhyML, Clustal Omega və MUSCLE kimi digər alətlər üçün obyektlər ikili faylları yükləmək üçün öz metodlarını ehtiva edir (aşağıya baxın)

Əsas istifadə:

Brauzeri localhost-a yönəldin: 8080

Qeyd: JBrowse server yaratmaq üçün o, burada təsvir edilən tərtibatçı təlimatlarına uyğun olaraq endirilməli və konfiqurasiya edilməlidir.

Əsas istifadə: node app.js index-file -U fastQ-oxuyur

Əsas istifadə: node app.js path-to-jar input-fayl [istənilən bayraqları daxil edin (aşağıdakı bayraqlardan)]

BAYRAQ ƏTRAFLI
ILLUMINACLIP Oxunandan adapteri və digər işıqlandırmaya xas ardıcıllığı kəsin
SÜRÜCÜ PƏNCƏRƏ Sürüşən pəncərənin kəsilməsini həyata keçirin
lider Keyfiyyət həddi aşağı olarsa, oxunmanın başlanğıcını kəsin
ARAYIŞ Keyfiyyət eşikindən aşağı olarsa, oxunuşun sonundan əsasları kəsin
ƏKİL Oxunu müəyyən uzunluğa kəsin
HEADCROP Oxumanın əvvəlindən müəyyən edilmiş sayda əsasları kəsin
MINLEN Müəyyən edilmiş uzunluqdan aşağı olarsa oxunu buraxın
TOPHRED33 Keyfiyyət ballarını Phred-33-ə çevirin
TOPHRED64 Keyfiyyət ballarını Phred-64-ə çevirin

Qeyd: Java Runtime mühiti və Trimmomatic jar olmalıdır

Bu əmrdən istifadə edərək PhyML-i yükləyin

Əsas istifadə: node app.js inputfile [istənilən bayraqları daxil edin (aşağıdakı bayraqlardan)]

BAYRAQ SAHƏ
-d məlumat_növü
-q
-n nb_data_sets
-b int
-m model
-f e
-t ts/tv_nisbəti
-v prop_invar
-c nb_subst_cat
-a qamma
-s hərəkət
-u user_tree_file
-o 'tlr'
--rand_start
--n_rand_başlayır ədəd
--r_toxum ədəd
--print_site_lnl
--print_trace

Əsas istifadə: node app.js fayl adı [-bayraqlar (aşağıdakı cədvəldən)]

BAYRAQLAR
-format_çıxış
-default_version=1
-io_version=4
-p3_settings_file= file_path
-echo_settings_fayl
-strict_tegs
-çıxış = fayl_yolu
-xəta = fayl_yolu

Əzələ proqramı yükləyin

Əsas istifadə: node app.js inputfile [əvvəlində '-' işarəsi olan və boşluqla ayrılmış istənilən bayraqları daxil edin (aşağıdakı bayraqlardan)]

BAYRAQ FUNKSİYA
-diaqlar Diaqonalları tapın (oxşar ardıcıllıqlar üçün daha sürətli)
-html Çıxışı HTML formatında yazın (standart FASTA)
-msf Çıxışı GCG MSF formatında yazın (defolt FASTA)
-clw Çıxışı CLUSTALW formatında yazın (standart FASTA)
-clwstrict -clw kimi, 'CLUSTAL W (1.81)' başlığı ilə
-sakit stderr-ə tərəqqi mesajları yazmayın

Clustal Omega proqramını yükləyin

Clustal Omega proqramını işə salın

Əsas istifadə: node app.js inputfile [əvvəlində '--' işarəsi olan və boşluqla ayrılmış istənilən bayraqları daxil edin]

BAYRAQ FUNKSİYA
--dolu Bələdçi ağacı hesablanması üçün tam məsafə matrisindən istifadə edin (yavaş mBed standartdır)
--tam-iter İterasiya zamanı bələdçi ağacının hesablanması üçün tam məsafə matrisindən istifadə edin (mBed standartdır)
--klaster ölçüsü Çıxışı GCG MSF formatında yazın (defolt FASTA)
--istifadə-kimura düzülmüş ardıcıllıqlar üçün Kimura məsafə korreksiyasından istifadə edin (defolt nömrə)
--faiz-id məsafələri faiz identifikasiyasına çevirin (standart nömrə)
--outfmt
--resno Clustal formatında çap qalıq nömrələri (defolt nömrə)
--bükmək çıxışda xətt sarılmasından əvvəl qalıqların sayı
--çıxış-sifariş
--iter (Birləşdirilmiş bələdçi ağacı/HMM) iterasiyaların sayı
--max-guidetree-iterations Maksimum bələdçi ağacı təkrarlamaları
--max-hmm-iterasiyalar HMM iterasiyalarının maksimum sayı

Əsas istifadə: node app.js inputfile [əvvəlində '-' işarəsi olan və boşluqla ayrılmış istənilən bayraqları daxil edin]

BAYRAQ FUNKSİYA
-gpo Açıq boşluq cəzası (defolt 6.0).
-gpe Boşluğun uzadılması cəzası (standart 0.9).
-səh Wu-Manber alqoritmi həm məsafənin hesablanmasında, həm də dinamik proqramlaşdırmada istifadə olunur
-w Wu-Manber alqoritmi ümumiyyətlə istifadə edilmir
-f sürətli evristik uyğunlaşdırma
-q 'sakit' - standart xətaya heç bir mesaj göndərilmir

Əsas istifadə: node app.js input.aln input.fasta [aşağıdan istənilən bayraq daxil edin]

BAYRAQ FUNKSİYA
-h kömək göstərmək
-yalnız blok Yalnız istifadəçi tərəfindən müəyyən edilmiş blokları göstərin
-çıxış (clustal,paml,fasta,codon) Çıxış formatı, default = clustal
-nogap boşluqlar və inframe stop kodonları olan sütunları çıxarın
- uyğunsuzluq uyğun olmayan kodonları (pep və cDNA arasında uyğunsuzluq) çıxışdan çıxarın
-kodonativ 1 (defolt),2,3,4,5,6,9,10,11,12,13,14,15,16,21,22,23 NCBI GenBank kodon cədvəli
-html HTML çıxışı (yalnız veb server üçün)
-nostderr STDERR mesajları yoxdur (yalnız veb server üçün)

Qeyd: Perl quraşdırılmalıdır

Əsas istifadə: node app.js input.paml input.trees [aşağıdan istənilən bayraq daxil edin]

BAYRAQ FUNKSİYA
- yenidən optimallaşdırın 0 (yox), 1 (bəli), 2 (budaq uzunluqlarını təsadüfi qiymətlərə təyin edin)
-kappa kappa üçün dəyər
- omeqa Omeqa üçün dəyər (dN/dS)
- branopt 0: sabit, 1: optimallaşdır, 2: mütənasib
-kodonf 0: F61/F60 1: F3x4 2: F1x4
-tezlik növü 0, 1, 2, 3
-yalnız müsbət 0 (yox) və ya 1 (bəli)
-nükleof 0: heç biri, 1: sabit N_ ilə tənzimləyin.
-aminof 0 (sabit), 1, 2
-tezlik növü 0, 1, 2, 3
-zaman real vaxt və istifadə olunan CPU vaxtının xülasəsi 1:bəli 0:yox
-atla Omeqanın sayta görə qiymətləndirilməsini atlayın

Əsas istifadə: node app.js input.cnt [cnt faylı tərəfindən təyin olunan bütün parametrlər]

Əsas istifadə: node app.js path-to-jar input-fayl [istənilən bayraqları daxil edin (aşağıdakı bayraqlardan)]

BAYRAQ ƏTRAFLI
-i alignment_filename
-t ağac_faylının adı (isteğe bağlı)
-o çıxış_faylının adı (isteğe bağlı)
-[matris] Matris daxil edin (amin turşusu)
dəyişməz saytların nisbəti olan modellər
-G saytlar və kateqoriyalar arasında dərəcə dəyişikliyi
-İG +I və +G ilə modellər
- bütün paylamalar saytlar, kateqoriyalar və hər ikisi arasında dərəcə dəyişikliyi
-ncat kateqoriyaların sayı
-F empirik tezlik qiymətləndirilməsi ilə modellər
-AIC Akaike Məlumat Kriteriyası
-BIC Bayes məlumat meyarı
-AICC Düzəliş edilmiş Akaike Məlumat Kriteriyası
-DT Qərar Nəzəriyyəsi Kriteriyası
-hamısı 7 çərçivəli müqayisə cədvəli
-S Optimallaşdırma strategiyası rejimi: [defolt: 0]
-s ML axtarışı üçün ağac axtarış əməliyyatı
-t1 Ən yaxşı modelin yeni ağacını göstərin
-t2 Ən yaxşı modelin ASCII ağacını göstərin
-tc Müəyyən edilmiş həddi olan konsensus ağacını göstərin
- iplər Hesablamaq üçün tələb olunan mövzuların sayı
- müfəssəl Verbose rejimi [defolt: false]

Qeyd: Java Runtime mühiti və ProtTest3 jar olmalıdır

Əsas istifadə: node app.js path-to-jar input-file -o output-file [istənilən bayraqları daxil edin (aşağıdakı bayraqlardan)]

BAYRAQ ƏTRAFLI
-a Hər bir aktiv meyar üçün model-ortalanmış filogeniyanı təxmin edin
-t Ehtimal hesablamaları üçün əsas ağac (məsələn, -t BIONJ)
-o çıxış faylı
-i Dəyişməz saytların nisbəti olan modelləri daxil edin
-maşın faylı Maşın faylından host başına prosessorları alır
-g numberOfRateCategories
-Filip alın Giriş faylını phylip formatına çevirir və çıxır
-G eşik
-h güvən intervalı
-AIC Akaike Məlumat Kriteriyası
-BIC Bayes məlumat meyarı
-AICc Düzəliş edilmiş Akaike Məlumat Kriteriyası
-hLRT İerarxik ehtimal nisbəti testlərini yerinə yetirin
-DT Qərar nəzəriyyəsi meyarını hesablayın
-f Qeyri-bərabər baza tezlikləri olan modelləri daxil edin
-H Klaster axtarışı üçün məlumat meyarı
-n logSffix
-O hLRT-lər üçün hipotez sırasını təyin edir
-səh Parametrlərin əhəmiyyətini hesablayın
-tr Hesablamaq üçün tələb olunan mövzuların sayı
-v Modelin orta hesablamasını və parametrlərin əhəmiyyətini yerinə yetirin
-s Əvəzetmə sxemlərinin sayını təyin edir
-u ağac faylı
-uLNL Qeyri-məhdud ehtimala qarşı delta AIC, AICc, BIC hesablayın
-w PAUP blokunu çap edir
-z Model-ortalanmış filogeniya üçün ciddi konsensus növü

Qeyd: Java Runtime mühiti və jModelTest2 jar olmalıdır

Əmrlər proqramlar arasında məlumat ötürmək üçün ardıcıl olaraq zəncirlənə bilər:

Pipes dir, boru kəmərləri üçün modul və nümunə faylları ehtiva edir. Məsələni yerinə yetirmək üçün:

pipe_example.js NCBI gətirmə API çağırışından gələn çıxışı MUSCLE uyğunlaşdırma proqramına ötürür və defolt parametrlərdən istifadə edərək DNT-ni hizalayır

Qeyd: boru nümunəsi üçün $PATH-də MUSCLE olmalıdır

phylo-node uğurla sınaqdan keçirildi:

  • Microsoft Windows 7 Enterprise ver.6.1
  • MacOSX El Capitan ver.10.11.5
  • Linux Ubuntu 64-bit ver.14.04 LTS

Bütün inkişaf asılılıqlarının quraşdırılmasını təmin etmək üçün:

Qeyd: testləri yerinə yetirərkən icazə xətası alsanız, chmod mocha-ya ehtiyacınız ola bilər

Skinner M.E., Uzilov A.V., Stein L.D., Mungall C.J., Holmes I.H. (2009). JBrowse: yeni nəsil genom brauzeri. Genom Araşdırma, 19(9):1630-1638

Langmead B, Salzberg S. (2012). Papyon 2 ilə sürətli boşluqla oxunan uyğunlaşma. Təbiət Metodları, 49(4):357-9

Bolger, A. M., Lohse, M., və Usadel, B. (2014). Trimmomatic: Illumina Sequence Data üçün çevik trimmer. Bioinformatika, btu170

Guindon S., Dufayard J.F., Lefort V., Anisimova M., Hordijk W., Gascuel O. (2010). Maksimum Ehtimal Filogeniyalarını Təxmin etmək üçün Yeni Alqoritmlər və Metodlar: PhyML 3.0 Performansının Qiymətləndirilməsi. Sistematik Biologiya, 59(3):307-21

Untergasser A, Cutcutache I, Koressaar T, Ye J, Faircloth BC, Remm M və Rozen SG. (2012). Primer3 - yeni imkanlar və interfeyslər. Nuklein turşuları Res. 40(15):e115

Edqar, R.C. (2004) MUSCLE: yüksək dəqiqlik və yüksək ötürmə qabiliyyəti ilə çox ardıcıl düzülmə. Nuklein turşuları Res. 32(5):1792-1797

Edqar, R.C. (2004) MUSCLE: azaldılmış vaxt və məkan mürəkkəbliyi ilə çox ardıcıl uyğunlaşdırma üsulu. BMC Bioinformatika, (5)113

Sievers F, Wilm A, Dineen DG, Gibson TJ, Karplus K, Li W, Lopez R, McWilliam H, Remmert M, Söding J, Thompson JD, Higgins DG (2011). Clustal Omega istifadə edərək yüksək keyfiyyətli zülal çoxlu ardıcıl düzülmələrin sürətli, genişlənə bilən nəsli. Molekulyar Sistemlər Biologiyası 7:539

Lassmann T, Sonnhammer EL. (2005). Kalign - dəqiq və sürətli bir neçə ardıcıllıqla uyğunlaşdırma alqoritmi. BMC Bioinformatika. 126:298

Suyama M, Torrents D, Bork P (2006). PAL2NAL: zülal ardıcıllığının uyğunlaşdırılmasının müvafiq kodon düzülüşünə möhkəm çevrilməsi. Nuklein turşuları Res. 34: W609-W612

Massingham T, Goldman N (2005) Müsbət seçim və təmizləyici seçim altında amin turşularının yerlərinin aşkarlanması. Genetika 169: 1853-1762

Yang, Z (2007) PAML 4: maksimum ehtimalla filogenetik analiz. Mol Biol Evol. 24(8):1586-91.

Yang, Z (1997) PAML: maksimum ehtimalla filogenetik analiz üçün proqram paketi. Comput Appl Biosci. 13(5):555-6

Darriba D, Taboada GL, Doallo R, Posada D. (2011). ProtTest 3: protein təkamülünün ən uyğun modellərinin sürətli seçimi. Bioinformatika, 27:1164-1165

Darriba D, Taboada GL, Doallo R, Posada D. (2012). jModelTest 2: daha çox model, yeni evristika və paralel hesablama. Təbiət üsulları 9(8), 772

Bütün töhfələr açıqdır.

Əgər hər hansı bir probleminiz və ya təklifiniz varsa, burada məsələni açın.

Müəllif hüququ (c) 2016, dohalloran

Bununla, bu proqram təminatının surətini və əlaqəli sənəd fayllarını ("Proqram təminatı") əldə edən hər bir şəxsə ödənişsiz olaraq proqram təminatı ilə məhdudiyyətsiz, o cümlədən məhdudiyyətsiz istifadə etmək, surətini çıxarmaq, dəyişdirmək, birləşdirmək hüquqları ilə məşğul olmaq icazəsi verilir. , Proqram təminatının nüsxələrini dərc etmək, yaymaq, sublisenziya vermək və/və ya satmaq və Proqram təminatının təqdim olunduğu şəxslərə aşağıdakı şərtlərlə bunu etməyə icazə vermək:

Yuxarıdakı müəllif hüququ bildirişi və bu icazə bildirişi Proqram təminatının bütün nüsxələrinə və ya əhəmiyyətli hissələrinə daxil edilməlidir.

PROQRAM TƏMİNATI "OLDUĞU KİMİ", HƏR NÖRDƏ, AÇIQ VƏ YA DEYNİ ZƏMANƏT OLMADAN, O cümlədən, MÜƏKSƏİ MƏQSƏDƏ UYĞUNLUQ VƏ QEYRİ MƏQSƏDLƏRƏ TƏMİN EDİLİR. MÜƏLLİF HÜQUQ SAHİBLƏRİ MÜƏLLİF HÜQUQ SAHİBLƏRİ MÜQAVİLƏDƏN GÖRƏN HƏRƏKƏTDƏ, HƏQİYYƏTDƏN VƏ YA BAŞQA HƏRƏKƏTLƏRDƏN, BAŞQA NƏZƏRDƏN ÇIXAN HƏR HƏR İDDİA, ZƏYAN VƏ YA DİGƏR MƏSULİYYƏTƏ görə MƏSULİYYƏT OLMAYIR. PROQRAM TƏMİNATI.


"Fokal"da proqramlar, Podseksiya elm

r57554-5) [kainat] Uels-İngilis apertium-dan cütü üçün apertium tərcümə məlumatları (0.6.0-2) [kainat] Danimarka apertium-dan-nor (1.4.1-1) üçün apertium vahid dil datası [kainat] Danimarka-Norveç cütü apertium-dev (3.6.1-1build2) üçün apertium tərcümə məlumatları [kainat] Apertium apertium-en-gl üçün inkişaf alətləri və kitabxana (0.5.2

r57551-3) [kainat] İngilis-Qalisiya cütü apertium-eng-cat üçün apertium tərcümə məlumatları (1.0.1-1) [kainat] İngilis-Katalan cütü apertium-eo-en (1.0.0) üçün apertium tərcümə məlumatları

r63833-3) [kainat] Esperanto və İngilis apertium-eo-fr (0.9.0) arasında tərcümə etmək üçün Apertium linqvistik məlumatlar

r57551-3) [kainat] Esperanto-Fransız cütü apertium-es-ast (1.1.0) üçün apertium tərcümə məlumatları

r51165-3) [kainat] İspan-Asturiya cütü apertium-es-it üçün apertium tərcümə məlumatları (0.2.0

r78826-2) [kainat] apertium-spa-ita apertium-eu-en (0.3.1) üçün keçid dummy paketi

r56205-3) [kainat] Bask-İngilis cütü apertium-eval-tərcüməçi üçün apertium tərcümə məlumatları (1.2.1-2) [kainat] Maşın tərcüməsi çıxışını istinad apertium-fra (1.5.0-1) ilə qiymətləndirin [kainat] Fransız apertium-fra-cat (1.7.0-1) üçün apertium vahid dil datası [kainat] Fransız-Katalan cütü apertium-hbs (0.5.0) üçün apertium tərcümə məlumatları

r68212-3) [kainat] Serb-Xorvat apertium-hbs-eng (0.1.0) üçün apertium vahid dil datası

r57598-2) [kainat] Serb-Xorvat - İngilis cütü apertium-hbs-mkd üçün apertium tərcümə məlumatları (0.1.0

r76450-4) [kainat] Serb-Xorvat-Makedoniya cütü apertium-hbs-slv (0.1.0) üçün apertium tərcümə məlumatları

r59294-2) [kainat] Serb-Xorvatiya-Sloveniya apertium-hin cütü üçün apertium tərcümə məlumatları (0.1.0)

r59158-2) [kainat] Hindi apertium-id-ms (0.1.1.1) üçün Apertium vahid dil datası

r57551-2) [kainat] İndoneziya-Malay cütü apertium-is-sv (0.1.0) üçün apertium tərcümə məlumatları

r76450-3) [kainat] İslandiya-İsveç cütü apertium-isl (0.1.0) üçün apertium tərcümə məlumatları

r65494-2) [kainat] İslandiya apertium-isl-eng üçün Apertium vahid dil datası (0.1.0

r66083-3) [kainat] İslandiya-İngilis apertium-ita cütü üçün apertium tərcümə məlumatları (0.10.0)

r82237-2) [kainat] İtalyan apertium-kaz üçün Apertium vahid dil məlumatları (0.1.0

r61338-2) [kainat] Qazax apertium-kaz-tat üçün apertium vahid dil məlumatları (0.2.1

r57554-2) [kainat] Qazax-tatar apertium-lex-tools cütü üçün apertium tərcümə məlumatları (0.2.3-1build2) [kainat] Məhdudiyyətə əsaslanan leksik seçim modulu aperium-mk-bg (0.2.0

r49489-3) [kainat] Makedoniya-Bolqar cütlüyü apertium-mk-en (0.1.1) üçün apertium tərcümə məlumatları

r57554-3) [kainat] Makedoniya-İngilis apertium-mlt-ara cütü üçün apertium tərcümə məlumatları (0.2.0

r62623-2) [kainat] Malta-ərəb cütü apertium-nno üçün apertium tərcümə məlumatları (1.0.0-2) [kainat] Norwegian Nynorsk apertium-nno-nob (1.3.0-1) üçün apertium vahid dil datası [kainat] Norwegian Nynorsk-Norwegian Bokmål cütü apertium-nob üçün apertium tərcümə məlumatları (1.0.0-2) [kainat] Norwegian Bokmål apertium-oci (0.1.0-1) üçün Apertium vahid dil datası [kainat] Occitan apertium-oci-fra (0.3.0-1) üçün apertium vahid dil datası [kainat] Oksitan-Fransız cüt apertium-pol üçün apertium tərcümə məlumatları (0.1.1-2) [kainat] Polyak apertium-por-cat üçün apertium vahid dil datası (0.9.0-1) [kainat] Portuqal-Katalan cütü üçün apertium tərcümə məlumatları apertium-rekursiv (0.0.1-1build1) [kainat] Apertium rekursiv struktur ötürmə modulu apertium-rus (0.2.0

r82706-1) [kainat] Rus apertiumla ayrıla bilən Apertium vahid dil məlumatları (0.3.3-1build1) [kainat] Ayrılan/bitişik olmayan çoxsözlərin yenidən sıralanması apertium-sme-nob (0.6.0)

r61921-2) [kainat] Şimali Sami-Norveç Bokmål cütü apertium-spa üçün apertium tərcümə məlumatları (1.1.0

r79716-2) [kainat] İspan apertium-spa-arg üçün Apertium vahid dil məlumatları (0.4.0

r64399-2) [kainat] İspan-Araqon cütü apertium-spa-cat üçün apertium tərcümə məlumatları (2.2.0-1) [kainat] İspan-Katalan cütü apertium-spa-ita üçün apertium tərcümə məlumatları (0.2.0

r78826-2) [kainat] İspan-İtalyan apertium-swe cütü üçün apertium tərcümə məlumatları (0.8.0-2) [kainat] İsveç apertium-swe-dan üçün Apertium vahid dil məlumatları (0.8.1-1) [kainat] İsveç-Danimarka apertium-swe-nor cütü üçün apertium tərcümə məlumatları (0.3.1-1) [kainat] İsveç-Norveç cütü apertium-szl üçün apertium tərcümə məlumatları (0.1.0-1) [kainat] Silesian apertium-tat üçün Apertium vahid dil məlumatları (0.1.0

r60887-2) [kainat] Tatar apertium-tur üçün apertium vahid dil məlumatları (0.2.0

r83161-2) [kainat] Türk apertium-ukr (0.1.0

r82563-2) [kainat] Ukrayna apertium-urd üçün apertium vahid dil məlumatları (0.1.0

r61311-2) [kainat] Urdu apertium-urd-hin üçün apertium vahid dil datası (0.1.0

r64379-2) [kainat] Urdu-Hindi cütü aragorn üçün apertium tərcümə məlumatları (1.2.38-2) [kainat] tRNT və tmRNA-nın nukleotid ardıcıllığında aşkarlanması arb (6.0.6-4build1) [multiverse] filogenetik ardıcıllığın təhlili paketi - əsas proqram arb-common (6.0.6-4build1) [multiverse] filogenetik ardıcıllığın təhlili paketi - ümumi fayllar arden (1.0-5) [kainat] süni istinad ariba (2.14.4+ds-2build1) istifadə edərək oxu düzülmələri üçün spesifiklik nəzarəti [kainat] Assembly art-nextgen-simulation-tools (20160605+dfsg-4) tərəfindən Antibiotik Müqavimətinin İdentifikasiyası [kainat] sintetik yeni nəsil ardıcıllıq yaratmaq üçün simulyasiya alətləri art-nextgen-simulation-tools-profiles (20160605+dfsg-4) [kainat] artemis sənət simulyasiya alətləri üçün profillər (17.0.1+dfsg-2) [kainat] genom brauzeri və annotasiya aləti artfastqgenerator (0.0.20150519-3) [kainat] istinad genomundan əldə edilən süni FASTQ fayllarını çıxarır artfastqgenerator-examples (0.0.20150519-3) [kainat] ou7 istinad genomundan (nümunələr) əldə edilmiş süni FASTQ fayllarını qoyur asdftool (2.5.1-1) [kainat] ASDF elmi məlumat fayllarını manipulyasiya etmək üçün komanda xətti aləti (3.19.0-1) [kainat] Atom Simulyasiya Mühitinin montajı (1.0+ds-2) [kainat] astro-tapşırıqlar (2.1) bir genom yığıncağından struktur variantlarını aşkar etmək və təhlil etməkkainat] Debian Astronomy Pure Blend (tapşırıq tapşırıqları) astromatik (1.2) [kainat] Astronomik boru kəməri proqramlarının toplanması astrometriya-məlumat-2kütlə (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi astrometry-data-2mass-00 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (2'-2.8') astrometry-data-2mass-01 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (2.8'-4') astrometry-data-2mass-02 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (4'-5.6') astrometry-data-2mass-03 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (5.6'-8') astrometry-data-2mass-04 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (8'-11') astrometry-data-2mass-05 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (11'-16') astrometry-data-2mass-06 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (16'-22') astrometry-data-2mass-07 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (22'-30') astrometry-data-2mass-08-19 (1.1) [multiverse] Astrometry.net 2MASS indeks faylları yükləyicisi (30'-2000') astrometry-data-tycho2 (2-4) [kainat] Astrometry.net Tycho-2 indeks faylları astrometry-data-tycho2-07 (2-4) [kainat] Astrometry.net Tycho-2 indeks faylları (22'-30') astrometry-data-tycho2-07-bigendian (2-4) [kainat] Astrometry.net Tycho-2 böyük endian indeks faylları (22'-30') astrometry-data-tycho2-07-littleendian (2-4) [kainat] Astrometry.net Tycho-2 kiçik endian indeks faylları (22'-30') astrometry-data-tycho2-08 (2-4) [kainat] Astrometry.net Tycho-2 indeks faylları (30'-44') astrometry-data-tycho2-08-bigendian (2-4) [kainat] Astrometry.net Tycho-2 böyük endian indeks faylları (30'-44') astrometry-data-tycho2-08-littleendian (2-4) [kainat] Astrometry.net Tycho-2 kiçik endian indeks faylları (30'-44') astrometry-data-tycho2-09 (2-4) [kainat] Astrometry.net Tycho-2 indeks faylları (44'-60') astrometry-data-tycho2-09-bigendian (2-4) [kainat] Astrometry.net Tycho-2 böyük endian indeks faylları (44'-60') astrometry-data-tycho2-09-littleendian (2-4) [kainat] Astrometry.net Tycho-2 kiçik endian indeks faylları (44'-60') astrometry-data-tycho2-10-19 (2-4) [kainat] Astrometry.net Tycho-2 indeks faylları (60'-2000') astrometry-data-tycho2-10-19-bigendian (2-4) [kainat] Astrometry.net Tycho-2 böyük endian indeks faylları (60'-2000') astrometry-data-tycho2-10-19-littleendian (2-4) [kainat] Astrometry.net Tycho-2 kiçik endian indeks faylları (60'-2000') astrometry.net (0.78+dfsg-3build2) [kainat] Astrometriya lövhəsi həlledicisi astronomik-almanak (5.6-6) [kainat] astronomik almanax - atropos planet və ulduz mövqelərini hesablayın (1.1.24+dfsg-1build1) [kainat] NGS xüsusi, həssas və sürətli avqust (3.3.3+dfsg-2build1) olan oxu kəsmə aləti [kainat] eukaryotik genomlarda gen proqnozu augustus-data (3.3.3+dfsg-2build1) [kainat] AUGUSTUS autodock üçün məlumat faylları (4.2.6-7build1) [kainat] protein strukturuna liqand bağlanmasının təhlili autodock-getdata (4.2.6-7build1) [kainat] birləşmələri toplamaq üçün getData üçün təlimatlar autodock-test (4.2.6-7build1) [kainat] AutoDock autodock-vina (1.1.2-5build3) üçün test faylları [kainat] kiçik molekulların zülalların avtoqridinə birləşməsi (4.2.6-7build1) [kainat] liqandların onların reseptorlarına bağlanmasını əvvəlcədən hesablayın autogrid-test (4.2.6-7build1) [kainat] AutoGrid avce00 (2.0.0-7) üçün test faylları [kainat] ESRI Arcinfo Vektor Əhatəsinin E00 formatına çevrilməsi avogadro (1.93.0-1) [kainat] Molekulyar Qrafika və Modelləşdirmə Sistemi avogadro-utils (1.93.0-3) [kainat] Molekulyar Qrafika və Modelləşdirmə Sistemi (kitabxana) axe-demultipleksator (0.3.3+dfsg-1) [kainat] Trie əsaslı DNT ardıcıllığı oxunan demultipleksator simit (1.2.2-1ubuntu1) [kainat] Hesablama Kimyası Paketi baitfisher (1.2.7+git20180107.e92dbf2+dfsg-1build1) [kainat] hibrid zənginləşdirmə zondlarının layihələndirilməsi üçün proqram paketi bali-phy (3.4.1+dfsg-2build1) [kainat] Alignment və Phylogeny haqqında Bayesian Nəticə ballview (1.5.0+git20180813.37fc53c-4build2) [kainat] pulsuz molekulyar modelləşdirmə və molekulyar qrafika alətləri (2.5.1+dfsg-5build1) [kainat] BAM (genom uyğunlaşdırılması) faylları sarğı ilə manipulyasiya etmək üçün alətlər dəsti (0.8.1-1build1) [kainat] Yeni Assambleya Qrafiklərində Naviqasiya üçün Bioinformatika Tətbiqi Asanlıqla barrnap (0.9+dfsg-1) [kainat] sürətli ribosomal RNT proqnozu bart (0.5.00-1) [kainat] hesablamalı maqnit rezonans görüntüləmə üçün alətlər bart-view (0.1.00-2) [kainat] çoxölçülü kompleks dəyərli məlumat bbmap üçün görüntüləyici (38.79+dfsg-1) [kainat] qısa oxumaq üçün hizalayıcı və digər bioinformatik alətlər bbmap-jni (38.79+dfsg-1) [kainat] qısa oxunuş aligner və digər bioinformatik alətlər - JNI library bcalm (2.2.1-2build1) [kainat] aşağı yaddaş bcftools de Bruijn sıxılma (1.10.2-2) [kainat] VCF/BCF fayllarının genomik variantının çağırılması və manipulyasiyası (1.1.18+dfsg-4build1) [kainat] 2-DE elektroforez gel image ləkə aşkarlama beagle (5.1-191125+dfsg-1) [kainat] Genotip çağırışı, genotip fazalanması və genotipsiz markerlərin təyini beast-mcmc (1.10.4+dfsg-2) [multiverse] Bayesian MCMC filogenetik nəticə beast2-mcmc (2.6.0+dfsg-1) [kainat] Bayesian MCMC filogenetik nəticə bazası (2.4.37+dfsg-2build1) [kainat] yüksək performanslı genomik xüsusiyyət əməliyyatları yataq alətləri (2.27.1+dfsg-4ubuntu1) [kainat] genomik xüsusiyyətləri müqayisə etmək üçün kommunal proqramlar dəsti bedtools-test (2.27.1+dfsg-4ubuntu1) [kainat] bedtools paketi belvu (4.44.1+dfsg-3build1) üçün sınaq məlumatları [kainat] çox ardıcıl düzülmə görüntüləyicisi və filogenetik alət berkeley-express (1.5.3+dfsg-1build1) [kainat] Yüksək məhsuldarlıqlı ardıcıllıqla bio-qartal üçün axın kəmiyyəti (2.4.1-1build2) [kainat] Genotiplənmiş kohort daxilində haplotip mərhələləri və ya mərhələli istinad paneli bio-qartal nümunələrindən istifadə etməklə (2.4.1-1build2) [kainat] Bio-qartal bio-göy qurşağı üçün nümunələr (2.0.4+dfsg-1) [kainat] bioinformatika biobambam2 üçün qısa oxunuşların toplanması və yığılması (2.0.95-1) [kainat] biogenezin ilkin mərhələdə uyğunlaşdırılması üçün alətlər (0.8-3) [kainat] bioperl orqanizmlərinin təkamülünü simulyasiya edən süni həyat proqramı (1.7.7-1) [kainat] Hesablama molekulyar biologiyası üçün Perl alətləri biooperl (1.7.3-3) [kainat] BioPerl sarğıları: biosquid skriptləri (1.9g+cvs20050121-11) [kainat] bioloji ardıcıllığın analizi biosintaksisi üçün utilitlər (1.0.0b-1) [kainat] Hesablama Biologiyası üçün Sintaksis İşıqlandırması (metapaket) biosintaksis-ümumi (1.0.0b-1) [kainat] Hesablama Biologiyası üçün Sintaksis İşıqlandırması (ümumi fayllar) biosintaksis nümunəsi (1.0.0b-1) [kainat] Hesablama Biologiyası üçün Sintaksis İşıqlandırması (nümunə) biosintaksis-gedit (1.0.0b-1) [kainat] Hesablama Biologiyası üçün Sintaksis İşıqlandırması (gedit) biosintaksissiz (1.0.0b-1) [kainat] Hesablama Biologiyası üçün Sintaksis İşıqlandırması (az) biosintaksis-vim (1.0.0b-1) [kainat] Hesablama Biologiyası üçün Sintaksis İşıqlandırması (vim) bitseq (0.7.5+dfsg-5build1) [kainat] Sequencing Data-dan Transkriptlərin Bayesian Nəticəsi (0.40-1) [kainat] ncurses blasr-da bitwise interaktiv əməliyyat (5.3.3+dfsg-4build1) [kainat] tək molekullu ardıcıllığın xəritələşdirilməsi partlayış2 (1:2.9.0-2) oxuyur.kainat] ncbi-blast+-legacy blimps-utils-ə keçid dummy paketi (3.9+ds-1) [multiverse] bloklar verilənlər bazası təkmilləşdirilmiş axtarışçı yanıb-sönür (4:19.12.3-0ubuntu1) [kainat] Simon elektron yaddaş oyunu blixeminin KDE versiyası (4.44.1+dfsg-3build1) [kainat] ardıcıl düzülmələrin interaktiv brauzeri bmt (0.6-1) [kainat] proqram təhlili müqayisə alət dəsti bodr (10-2) [kainat] Blue Obelisk Data Repository boinc-app-seti (8.00

svn4035-1build1) [kainat] BOINC müştərisi üçün [email protected] tətbiqi boinc-app-seti-graphics (8.00)

svn4035-1build1) [kainat] BOINC müştərisi üçün [email protected] tətbiqi (qrafiklə) bolt-lmm (2.3.4+dfsg-2build1) [kainat] Effektiv böyük kohortlar genom boyu Bayes qarışıq modelli assosiasiya testi bolt-lmm-misal (2.3.4+dfsg-2build1) [kainat] Bolt-lmm boolektor üçün nümunələr (1.5.118.6b56be4.121013-1build1) [kainat] Bit vektorları və massivləri üçün SMT həlledicisi (1.2.3+dfsg-4build1) [kainat] Ultra sürətli yaddaşa qənaət edən qısa oxumaq üçün düzləşdirici papyon nümunələri (1.2.3+dfsg-4build1) [kainat] Papyon üçün nümunələr, ultra sürətli yaddaşa qənaət edən qısa oxumaq üçün düzləşdirici papyon2 (2.3.5.1-6build1) [kainat] ultrasürətli yaddaşa qənaət edən qısa oxunuş düzləşdirici papyon 2-nümunələr (2.3.5.1-6build1) [kainat] Bowtie2 qutu kölgəsi üçün nümunələr (3.3.1-13) [kainat] Çox ardıcıl düzülmələrin gözəl çapı bppphyview (0.6.1-1build1) [kainat] Bio++ Filogenetik Baxıcı bppsuite (2.4.1-1build1) [kainat] Bio++ proqram paketi bppsuite-nümunələr (2.4.1-1build1) [kainat] Bio++ proqram paketi üçün nümunələr (0.95+dfsg-3) [kainat] BLAST Ring Image Generator bwa (0.7.17-4) [kainat] Burrows-Wheeler Aligner cafeobj (1.6.0-2) [kainat] yeni nəsil cəbri spesifikasiya və proqramlaşdırma dili cafeobj-mode (1.6.0-2) [kainat] CafeOBJ mənbə kodunu redaktə etmək üçün Emacs əsas rejimi caffe-tools-cpu (1.0.0+git20180821.99bd997-5build3) [kainat] Dərin Öyrənmə (CPU_ONLY) üçün sürətli, açıq çərçivə üçün alətlər (2.0.2-2) [multiverse] DNT ardıcıllığı birləşmələrinin saxlanması calculix-ccx (2.11-1build3) [kainat] Üçölçülü Struktur Sonlu Element Proqramı calculix-cgx (2.11+dfsg-1build1) [kainat] Calculix cgx fem callisto (1.1.0-2) üçün 3 ölçülü pre- və post-prosessordur [kainat] e-Callisto hardware camitk-actionstatemachine (4.1.2-4build1) üçün Daemon [kainat] CamiTK kitabxanası camitk-config (4.1.2-4build1) üçün boru kəmərinin təkrar oynatma proqramı [kainat] Computer Assisted Medical Intervention Tool Kit - config camitk-imp (4.1.2-4build1) [kainat] CamiTK kitabxanası üçün tezgah tətbiqi canu (1.9+dfsg-1build1) [kainat] genomlar üçün tək molekul ardıcıllığı montajçısı casacore-data-igrf (12-1) [kainat] Casacore casacore-data-jpl-de200 (2007.07.05+ds.1-1) üçün Beynəlxalq Geomaqnit İstinad Sahəsi məlumatları [kainat] Casacore casacore-data-jpl-de405 (2007.07.05+ds.1-1) üçün Reaktiv Sürüşmə Laboratoriyasının İnkişafı Ephemeris DE200 [kainat] Casacore casacore-data-lines üçün Jet Propulsion Laboratory Development Ephemeris DE405 (0+git2016.11.26-2) [kainat] Casacore casacore-data-rəsədxanaları üçün spektral xətt tezlikləri cədvəli (0+git2018.12.08-2) [kainat] Casacore casacore-məlumat mənbələri üçün radio rəsədxanasının koordinatları cədvəli (2-2) [kainat] Casacore casacore-data-tai-utc üçün ICRF istinad mənbə koordinatları cədvəli (1.2) [kainat] Casacore casacore alətləri üçün TAI və UTC arasındakı fərq cədvəli (3.2.1-4build3) [kainat] CASA cassbeam ilə qurulmuş alətlər (1.1-2) [kainat] Cassegrain antenna modelləşdirmə cassiopee (1.0.9-2build1) [kainat] genom ardıcıllığında indeks və axtarış aləti cba (0.3.6-5build1) [kainat] Davamlı Şüa Analizi cbflib-bin (0.9.5.18+dfsg1-1build1) [kainat] CBF fayllarını manipulyasiya etmək üçün utilitlər cbmc (5.10-5ubuntu1) [kainat] C və C++ proqramları üçün məhdud model yoxlayıcısı cclib (1.6.2-2) [kainat] Hesablama kimyası üçün təhlil və alqoritmlər cclib-data (1.6.2-2) [multiverse] Hesablama kimyası üçün təhlillər və alqoritmlər (məlumat faylları) cct (20170919+dfsg-1) [kainat] bakterial, plazmid, xloroplast və ya mitoxondrial ardıcıllıqların vizual müqayisəsi cct-nümunələr (20170919+dfsg-1) [kainat] cct cd-hit (4.8.1-2build1) paketini sınamaq üçün nümunə data [kainat] cdbfasta (0.99-20100722-6build1) ardıcıllıqlarını tez qruplaşdırmaq üçün nəzərdə tutulmuş proqramlar dəsti [kainat] Çox FASTA faylları sentrifuqa üçün Daimi DataBase indeksləşdirmə və axtarış alətləri (1.0.3-3build1) [kainat] DNT ardıcıllığının təsnifatı üçün sürətli və yaddaşa qənaət edən sistem cernlib (20061220+dfsg3-4.4build1) [kainat] CERNLIB məlumat təhlili paketi - ümumi istifadə metapaketi cernlib-core (20061220+dfsg3-4.4build1) [kainat] CERNLIB məlumat təhlili paketi - əsas kitabxanalar və proqramlar cernlib-core-dev (20061220+dfsg3-4.4build1) [kainat] CERNLIB məlumat təhlili paketi - əsas inkişaf faylları cernlib-əlavələr (20061220+dfsg3-4.4build1) [kainat] CERNLIB məlumat təhlili dəsti - əlavə proqramlar cernlib-montecarlo (20061220+dfsg3-3.1build4) [kainat] CERNLIB Monte Karlo kitabxanaları cg3 (1.3.1-2build3) [kainat] Məhdudiyyət Qrammatikasının (CG-3) cg3-dev (1.3.1-2build3) 3-cü nəşrindən istifadə üçün alətlər [kainat] Həm CG-3 CLI inkişaf alətləri, həm də cgns-convert (3.4.0-1) dev kitabxanasını təmin edən metapaket [kainat] CFD Ümumi Qeyd Sistemi - Konversiya alətləri cgview (0.0.20100111-4) [kainat] Dairəvi Genom Baxıcı dəyişdirmə (0.4.6-1) [kainat] Repertuarın klonal təyinat alətləri dəsti (Python 3) checkit-tiff (0.2.3-2) [kainat] əsas TIFF kimyəvi strukturları üçün uyğunluq yoxlayıcısı (2.2.dfsg.0-15) [kainat] açıq formatlarda molekulyar strukturlar toplusu chemps2 (1.8.9-1build3) [kainat] Chemtool (1.6.14-5) əmr satırından libchemps2-3-ə zəng etmək üçün icra edilə bilən [kainat] kimyəvi strukturların rəsm proqramı chimeraslayer (20101212+dfsg1-3) [kainat] PCR gücləndirilmiş DNT xromunda ehtimal olunan kimeraları aşkar edir (1.20+dfsg-1) [kainat] Xromatin vəziyyətinin kəşfi və xarakteristikası xromimput (1.0.3+dfsg-1) [kainat] Geniş miqyaslı sistematik epigenom imputasiya sirkulyatoru (1.5.6-1) [kainat] genom birləşmələrinin sirkulyasiyası (0.69.9+dfsg-1) [kainat] məlumat sirkos-alətlərini vizuallaşdırmaq üçün plotter (0.23-1) [kainat] verilənlərin vizuallaşdırılması üçün plotter - köməkçi utilitlər ckon (0.7.1-3build13) [kainat] ROOT məlumatların təhlili proqram təminatı üçün avtomatik qurma aləti (1.0.9-5) [kainat] son ​​dərəcə səmərəli filogenetik ağacın yenidən qurulması klonal çərçivə (1.2-10build1) [kainat] multilocus ardıcıllığı data clonalframeml (1.12-1) istifadə edərək bakterial mikrotəkamül nəticə çıxarmaq [kainat] Tam Bakterial Genomlarda Rekombinasiyanın Effektiv Nəticəsi klonalorigin (1.0-3build1) [kainat] clustalo (1.2.4-4build1) bütün genom ardıcıllığından istifadə edərək bakteriyalarda homoloji rekombinasiyanın nəticəsi.kainat] Zülalların çoxluğu üçün ümumi məqsədli çox ardıcıl uyğunlaşdırma proqramı (2.1+lgpl-6build1) [kainat] qlobal çoxlu nukleotid və ya peptid ardıcıllığının uyğunlaşdırılması klastalx (2.1+lgpl-8build1) [multiverse] Nuklein turşusu və zülal ardıcıllığının çoxlu düzülüşü (qrafik interfeys) klaster3 (1.59+ds-1) [multiverse] Eisen-klasterləşdirmə proqram təminatı cmor-cədvəllərinin yenidən tətbiqi (3.3-1) [kainat] Climate Model Output Rewriter kitabxanası cmtk (3.3.1p1+dfsg-2build1) üçün MIP cədvəlləri [kainat] Computational Morphometry Toolbar cnvkit (0.9.6-3) [kainat] Hədəflənmiş DNT sıralama cod alətlərindən nömrə variantının aşkarlanmasını kopyalayın (2.10+dfsg-1) [kainat] CIF formatlı faylları manipulyasiya etmək üçün alətlər kod-saturne (6.0.2-1) [kainat] Ümumi təyinatlı Hesablama Maye Dinamikasının (CFD) proqram kodu-saturne-bin (6.0.2-1) [kainat] Ümumi təyinatlı Computational Fluid Dynamics (CFD) proqramı - ikili kod-saturne-data (6.0.2-1) [kainat] Ümumi təyinatlı Computational Fluid Dynamics (CFD) proqramı - data code-saturne-include (6.0.2-1) [kainat] Ümumi təyinatlı Computational Fluid Dynamics (CFD) proqramı - codonw (1.4.4-4) daxildir [kainat] Kodon İstifadəsinin Yazışma Təhlili coinor-cbc (2.10.3+repack1-1build1) [kainat] Sikkə və ya budaq və kəsilmiş qarışıq tam ədəd proqramlaşdırma həlledicisi coinor-clp (1.17.5+repack1-1) [kainat] Sikkə və ya xətti proqramlaşdırma həlledicisi coinor-csdp (6.2.0-1) [kainat] Yarımmüəyyən proqramlaşdırma üçün proqram paketi coinor-libcbc3 (2.10.3+repack1-1build1) [kainat] Sikkə və ya filial və kəsilmiş qarışıq tam proqramlaşdırma həlledicisi (paylaşılan kitabxanalar) coinor-libcgl1 (0.60.3+repack1-2) [kainat] COIN-OR Cut Generation Library coinor-libclp1 (1.17.5+repack1-1) [kainat] Sikkə və ya xətti proqramlaşdırma həlledicisi (paylaşılan kitabxanalar) coinor-libcoinutils3v5 (2.11.4+repack1-1) [kainat] Sikkə və ya kommunal siniflər kolleksiyası (ikiliklər və kitabxanalar) coinor-libflopc++0v5 (1.0.6-3.1ubuntu3) [kainat] C++-da Xətti Optimallaşdırma Problemlərinin Tərtib edilməsi coinor-libosi1v5 (0.108.6+repack1-1) [kainat] COIN-OR Open Solver Interface coinor-libsymphony3 (5.6.16+repack1-2build1) [kainat] Qarışıq tam ədədli xətti proqramlar (paylaşılan kitabxanalar) üçün COIN-OR həlledicisi coinor-libvol1 (1.5.4-4) [kainat] Sikkə və ya xətti proqramlaşdırma həlledicisi (kitabxanalar) sikkə-simfoniya (5.6.16+repack1-2build1) [kainat] Qarışıq tam ədədli xətti proqramlar üçün COIN-OR həlledicisi (3.6+dev2+git20191105-1build1) [kainat] Structure-from Motion və Multi-View Stereo komet-ms (2018012-1build1) [kainat] Tandem Kütləvi Spektrometriya (MS/MS) axtarış mühərriki konkavliyi (0.1+dfsg.1-4build1) [kainat] zülal liqandının bağlanma yerlərinin quruluşundan və konservasiyasından konda-paketlə işləmə (1.6.0-2build1) [kainat] müxtəlif formatlı conda paketlərini yaradın və çıxarın connectome-workbench (1.4.2-1build1) [kainat] beyin vizualizasiyası, təhlili və kəşf aləti konservasiya kodu (20110309.0-8) [kainat] zülal ardıcıllığının qorunması skorlama aləti cp2k (6.1-3ubuntu2) [kainat] Ab Initio Molecular Dynamics cp2k-data (6.1-3ubuntu2) [kainat] Ab Initio Molecular Dynamics (məlumat faylları) cpl-plugin-amber (4.3.9+dfsg-2) [kainat] AMBER aləti üçün ESO məlumatların azaldılması boru kəməri cpl-plugin-amber-calib (4.3.9+dfsg-2) [kainat] AMBER cpl-plugin-fors (5.4.3+dfsg-1build1) üçün ESO məlumatların azaldılması boru kəmərinin kalibrlənməsi məlumat yükləyicisi [kainat] FORS1/2 alətləri üçün ESO məlumatların azaldılması boru kəməri cpl-plugin-fors-calib (5.4.3+dfsg-1build1) [kainat] FORS2 cpl-plugin-giraf (2.16.5+dfsg-1) üçün ESO məlumatların azaldılması boru kəmərinin kalibrlənməsi məlumat yükləyicisi [kainat] GIRAFFE aləti cpl-plugin-giraf-calib (2.16.5+dfsg-1) üçün ESO məlumatların azaldılması boru kəməri [kainat] GIRAFFE cpl-plugin-hawki (2.4.6+dfsg-1build1) üçün ESO məlumatların azaldılması boru kəmərinin kalibrlənməsi məlumat yükləyicisi [kainat] HAWK-I aləti cpl-plugin-hawki-calib (2.4.6+dfsg-1build1) üçün ESO məlumatların azaldılması boru kəməri [kainat] HAWK-I cpl-plugin-muse (2.8.1+dfsg-1) üçün ESO məlumatların azaldılması boru kəmərinin kalibrlənməsi məlumat yükləyicisi [kainat] MUSE aləti cpl-plugin-muse-calib (2.8.1+dfsg-1) üçün ESO məlumatların azaldılması boru kəməri [kainat] MUSE cpl-plugin-naco (4.4.8+dfsg-1) üçün ESO məlumatların azaldılması boru kəmərinin kalibrləmə məlumat yükləyicisi [kainat] NaCo aləti cpl-plugin-naco-calib (4.4.8+dfsg-1) üçün ESO məlumatların azaldılması boru kəməri [kainat] ESO məlumatların azaldılması boru kəməri NaCo kalibrləmə məlumat yükləyicisi cpl-plugin-uves (5.10.4+dfsg-1) [kainat] UVES aləti cpl-plugin-uves-calib (5.10.4+dfsg-1) üçün ESO məlumatların azaldılması boru kəməri [kainat] UVES cpl-plugin-vimos (3.3.0+dfsg-1build1) üçün ESO məlumatların azaldılması boru kəmərinin kalibrlənməsi məlumat yükləyicisi [kainat] VIMOS aləti cpl-plugin-vimos-calib (3.3.0+dfsg-1build1) üçün ESO məlumatların azaldılması boru kəməri [kainat] VIMOS cpl-plugin-visir (4.3.8+dfsg-1) üçün ESO məlumatların azaldılması boru kəmərinin kalibrlənməsi məlumat yükləyicisi [kainat] VISIR aləti cpl-plugin-visir-calib (4.3.8+dfsg-1) üçün ESO məlumatların azaldılması boru kəməri [kainat] VISIR cpl-plugin-xshoo (3.3.5+dfsg-2) üçün ESO məlumatların azaldılması boru kəmərinin kalibrlənməsi məlumat yükləyicisi [kainat] XSHOOTER aləti cpl-plugin-xshoo-calib (3.3.5+dfsg-2) üçün ESO məlumatların azaldılması boru kəməri [kainat] XSHOOTER cpuinfo (0.0) üçün ESO məlumatların azaldılması boru kəmərinin kalibrlənməsi məlumat yükləyicisi

git20190201.d5e37ad-2) [kainat] CPU MƏLUMAT kitabxanası (ikili yardım proqramları) crac (2.5.2+dfsg-2build2) [kainat] inteqrasiya edilmiş RNT-Seq oxu analizi kritterinqi (1.0-beta12.1-1.3build1) [kainat] İnkişaf edən Süni Həyat ctd çeviricisi (2.1-1) [kainat] CTD fayllarını Galaxy alətinə və CWL CommandLineTool fayllarına ctsim (6.0.2-3build1) çevirin [kainat] Kompüterli tomoqrafiya simulyatoru ctsim-help (6.0.2-3build1) [kainat] CTSim qol düymələri üçün onlayn yardım faylı (2.2.1+dfsg.1-7) [multiverse] Transkript yığılması, diferensial ifadə və RNT-Seq cutadapt (2.8-2build1) üçün tənzimləmə [kainat] Yüksək məhsuldarlıqlı ardıcıllıqdan təmiz bioloji ardıcıllıqlar cwltool (2.0.20200224214940+dfsg-1) [kainat] Ümumi İş Akışı Dili arayış tətbiqi daligner (1.0+git20200115.c2b47da-1) [kainat] uzun nukleotid ardıcıllığı arasında yerli uyğunlaşma kəşfi qaranlıq şəbəkəni oxuyur (0.0.0+git20180914.61c9d02e-2build2) [kainat] C dascrubber-də Açıq Mənbəli Neyron Şəbəkələri (1.1-1) [kainat] DNT ardıcıllığı üçün hizalamaya əsaslanan ovma boru kəməri datalad (0.12.4-2) oxuyur.kainat] məlumat fayllarının idarə edilməsi və paylama platforması datalad-konteyner (1.0.0-2) [kainat] Konteyner mühitləri ilə işləmək üçün DataLad genişləndirilməsi dawg (1.2-2build1) [kainat] rekombinant DNT ardıcıllığının təkamülünü simulyasiya edin dazzdb (1.0+git20200115.d8adde7-2) [kainat] nukleotid sıralamasını idarə edin oxu data dcm2niix (1.0.20181125-1build1) [kainat] növbəti nəsil DICOM-dan NIfTI çeviricisi dcmtk (3.6.4-2.1build2) [kainat] OFFIS DICOM alətlər dəsti komanda xətti utilitləri debian-astro-logo (2.1) [kainat] Debian Astronomy Pure Blends Logosu deepnano (0.0+git20170813.e8a621e-3.1) [kainat] MinION üçün alternativ baza çağırıcı dərinnano-məlumatların genomik ardıcıllıqlarını oxuyur (0.0+git20170813.e8a621e-3.1) [kainat] genomik ardıcıllıqların (məlumatların) MinION oxunuşları üçün alternativ baza çağırıcısı (0.8.2-1) [kainat] Oxu analizi ilə struktur variantının kəşfi dh-r (20200104) [kainat] R kitabxanalarının qablaşdırılması üçün Debian köməkçi alətləri dialign (2.2.1-10) [kainat] Seqment əsaslı çoxlu ardıcıl düzülmə dialign-tx (1.0.2-12) [kainat] Seqmentə əsaslanan çox ardıcıl düzülmə dialign-tx-data (1.0.2-12) [kainat] Seqment əsaslı çoxlu ardıcıl düzülmə (məlumat faylları) almaz düzləşdirici (0.9.30-3) [kainat] sürətləndirilmiş BLAST uyğun yerli ardıcıllıq düzləşdirici dicomnifti (2.33.1-1build1) [kainat] DICOM fayllarını NIfTI dimbl formatına çevirir (0.15-2.1build1) [kainat] Paylanmış Yaddaş Əsaslı Öyrənici dindel (1.01-wu1-3+dfsg-1build1) [kainat] qısa oxunmuş məlumat disulfinderindən indel çağırışlarını müəyyən edir (1.2.11-8build1) [kainat] sisteinlərin disulfid bağlanma vəziyyəti və əlaqənin proqnozlaşdırıcısı disulfinder-məlumatlar (1.2.11-8build1) [kainat] zülallarda disulfid bağlarının proqnozlaşdırıcısı üçün məlumat faylları dlmodelbox (1.1.1-1) [kainat] İsveçrə Ordusu Bıçağı Dərin Öyrənmə Modelləri dnaclust (3-7build1) [kainat] milyonlarla qısa DNT ardıcıllığının qruplaşdırılması üçün alət doris (5.0.3

beta+dfsg-13build1) [multiverse] Delft obyekt yönümlü radar interferometrik proqram dotter (4.44.1+dfsg-3build1) [kainat] iki genomik ardıcıllığın ətraflı müqayisəsi dozzaqueux (3.51-2) [kainat] kimyəvi qarışıqlar üçün simulyator dozzaqueux-data (3.51-2) [kainat] kimyəvi qarışıqlar üçün verilənlər bazası dpuser (4.0+dfsg-2build1) [kainat] Rəqəmlərin, sətirlərin və matrislərin idarə edilməsi üçün interaktiv dil drawxtl (5.5-5build1) [kainat] kristal quruluşa baxan drslib (0.3.1.p3-2) [kainat] Data Reference Sintaksis kitabxanası üçün komanda xətti alətləri dsdp (5.8-9.4build1) [kainat] Yarımmüəyyən Proqramlaşdırma üçün proqram təminatı dssp (3.0.0-3build1) [kainat] 3D strukturuna əsaslanan zülalın ikinci dərəcəli struktur təyini dwgsim (0.1.12-3) [kainat] qısa ardıcıllıq oxu simulyatoru dx (1:4.4.4-12build2) [kainat] OpenDX (IBM Visualization Data Explorer) - dxf2gcode əsas paketi (20170925-4) [kainat] avtomatik dəzgahlar üçün hissələrin çertyojlarını hazırlayır dxsamples (4.4.0-4) [kainat] OpenDX Data Explorer e-mem (1.0.1-2build1) üçün nümunə proqramlar [kainat] Çox böyük genomlar üçün Maksimal Dəqiq Uyğunluqların səmərəli hesablanması e00compr (1.0.1-5) [kainat] Arcinfo sıxılmış E00 fayllarını oxumaq/yazmaq üçün proqram ea-utils (1.1.2+dfsg-5build1) [kainat] bioloji ardıcıllıq məlumatlarının emalı üçün komanda xətti alətləri easychem (0.6-8build1) [kainat] Yüksək keyfiyyətli molekulları və 2D kimyəvi formulları çəkin (4.0.1-1) [kainat] müştərilər ECMWF obyektlərinə daxil olmaq üçün ecflow-client (4.17.1-1build2) [kainat] Meteoroloji iş axını ekflow-server üçün müştəri alətləri (4.17.1-1build2) [kainat] Meteoroloji iş axını nəzarətçisi - server ecopcr (1.0.1+dfsg-1) [kainat] PCR ştrix kod astarlarının keyfiyyətini qiymətləndirin edfbrowser (1.72+dfsg-1) [kainat] bdf və edf edlib-aligner (1.2.4-2ubuntu1) kimi biosiqnal saxlama faylları üçün görüntüləyici [kainat] redaktə məsafəsi edtsurf (0.2009-6build1) istifadə edərək edlib ardıcıllıqla uyğunlaşdırma aləti [kainat] protein strukturları üçün üçbucaqlı mesh səthlər eigensoft (7.2.1+dfsg-1build1) [multiverse] genetik analizlər üçün populyasiya meylinin azaldılması elk-lapw (6.3.2-1) [kainat] Bütün Elektron Sıxlığı-Funksional Elektron Struktur Kodu elki (0.7.1-10.1) [kainat] Data mining alqoritm inkişaf çərçivəsi elki-dev (0.7.1-10.1) [kainat] Data mining alqoritm inkişaf çərçivəsi - inkişaf faylları elph (1.0.1-4build1) [kainat] DNT/zülal ardıcıllığı motiv tapıcı səfirlik-domainatrix (0.1.660-3) [kainat] Domen təsnifat faylını idarə etmək üçün əlavə EMBOSS əmrləri embasy-domalign (0.1.660-3) [kainat] Zülal domeninin uyğunlaşdırılması üçün əlavə EMBOSS əmrləri embasy-domsearch (1:0.1.660-3) [kainat] Embassy-phylip protein domenlərini axtarmaq üçün əlavə EMBOSS əmrləri (3.69.660-3) [multiverse] Phylip paket qabartmasında proqramların EMBOSS çevrilmələri (6.6.0+dfsg-7ubuntu2) [kainat] Avropa molekulyar biologiya açıq proqram paketi kabartma məlumatı (6.6.0+dfsg-7ubuntu2) [kainat] EMBOSS paketi emboss-explorer (2.2.0-10) üçün məlumat faylları [kainat] web-əsaslı GUI-dən emmax (0

beta.20100307-1) [kainat] populyasiya strukturunu nəzərə alaraq genetik xəritələşdirmə məşğul-digitizer (10.10+ds.1-1build1) [kainat] bitmap qrafiklərindən və ya xəritələrdən interaktiv şəkildə nömrələri çıxarır (1.2debian-2) [kainat] yalançı təsadüfi nömrə ardıcıllığı test proqramı epigrass (2.5.0+dfsg-1build1) [kainat] şəbəkə epidemiologiyasında simulyasiyalar və ssenari təhlili üçün elmi alət epsilon-bin (0.9.2+dfsg-4) [kainat] Dalğalı təsvirin sıxılması üçün kitabxana - alətlər ergo (3.8-1build1) [kainat] Genişmiqyaslı hesablamalar üçün kvant kimya proqramı erqo-məlumatlar (3.8-1build1) [kainat] Geniş miqyaslı hesablamalar üçün kvant kimya proqramı - məlumat paketi eso-midas (19.02pl1.1-1build1) [kainat] Avropa Cənub Rəsədxanası Münhen Şəkil Məlumat Təhlili Sistemi eso-midas-testdata (19.02pl1.1-1build1) [kainat] ESO-MIDAS eso-boru kəmərləri üçün test məlumat faylları (1.3) [kainat] ESO VLT Alət boru kəməri kolleksiyası esorex (3.13.2+dfsg-3build1) [kainat] Avropa Cənub Rəsədxanası boru kəmərləri estscan üçün İcra Aləti (3.0.3-3build1) [kainat] DNT ardıcıllığının kodlaşdırılmasının ORF-dən asılı olmayan detektoru esys-hissəcik (2.3.5+dfsg1-4build2) [kainat] Hissəciklərə əsaslanan ədədi modelləşdirmə üçün proqram təminatı (MPI versiyası) etsf-io (1.0.4-4build2) [kainat] ETSF fayllarını yoxlamaq, birləşdirmək və oxumaq üçün ikili alətlər (3.0.21-3) [kainat] Filogenetik nəticə çıxarmaq üçün Exascale Maksimum İhtimal (ExaML) kodu (2.4.0-4) [kainat] cüt ardıcıllıq müqayisəsi üçün ümumi alət (4.6.2-1) [kainat] elmi təcrübələri inkişaf etdirmək üçün aparat və proqram təminatı çərçivəsi expeyes-clib (4.6.2-1) [kainat] elmi təcrübələr gözünü inkişaf etdirmək üçün aparat və proqram təminatı çərçivəsi (19.0928.2249)

ds-1) [kainat] semantik veb əsaslandırma mühərriki gözlər17 (4.6.2-1) [kainat] elmi təcrübələri sürətli5 inkişaf etdirmək üçün aparat və proqram təminatı çərçivəsi (0.6.5-4build1) [kainat] Oxford Nanopore Fast5 fayllarını manipulyasiya etmək üçün kommunallar fasta3 (36.3.8h-2) [multiverse] bioloji ardıcıllıq kolleksiyalarının axtarışı üçün alətlər fasta3-doc (36.3.8h-2) [multiverse] FASTA alətləri fasthack (1.0.0+dfsg-5build1) üçün istifadəçi təlimatı [kainat] FASTA fayllarından indeksləşdirmə və ardıcıllığın çıxarılması üçün yardım proqramı fastaq (3.17.0-2) [kainat] FASTA və FASTQ fayl manipulyasiya alətləri fastdnaml (1.2.2-14) [kainat] Fastlink DNT ardıcıllığının filogenetik ağaclarının qurulması üçün alət (4.1P-fix100+dfsg-2) [kainat] Linkage fastlink-doc damazlıq proqramlarının daha sürətli versiyası (4.1P-fix100+dfsg-2) [kainat] Fastlink fastml (3.11-2build1) haqqında bəzi sənədlər [kainat] maksimum ehtimal atalarının amin turşusu ardıcıllığının yenidən qurulması fastp (0.20.0+dfsg-1build1) [kainat] Ultra sürətli hamısı bir yerdə FASTQ preprosessor fastqc (0.11.9+dfsg-2) [kainat] yüksək ötürmə ardıcıllığı datası üçün keyfiyyətə nəzarət fastqtl (2.184+dfsg-7build2) [kainat] Fasttree molekulyar fenotipləri üçün cis-də Kəmiyyət Xüsusiyyət Yerləri (QTL) mapper (2.1.11-1) [kainat] fcc (2.8-1build3) nukleotid və ya zülal ardıcıllığının düzülüşündən filogenetik ağaclar [kainat] C/C++ proqramlarını tərtib etmək və Fortran kitabxanalarına keçid üçün skript feedgnuplot (1.53-1) [kainat] Gnuplot ffindex (0.9.9.9-3) üçün boru yönümlü ön hissə [kainat] böyük miqdarda kiçik fayllar üçün sadə indeks/verilənlər bazası figtree (1.4.4-4) [kainat] qrafik filogenetik ağac görüntüləyicisi fitgcp (0.0.20150429-3) [kainat] fitscut qarışıq modelləri ilə uyğun genom əhatə dairəsi paylanması (1.4.4-5) [kainat] FITS şəkil format fayllarından kəsikləri çıxarın fitsh (0.9.2-1) [kainat] Astronomik təsvirin işlənməsi üçün proqram paketi fitspng (1.4-1build1) [kainat] FITS to PNG çevirici fitsverify (4.20-1build1) [kainat] FITS Fayl Formatını Doğrulama Aləti fityk (1.3.1-5build1) [kainat] ümumi təyinatlı qeyri-xətti əyri uyğunlaşdırma və məlumat təhlili çevik çubuğu (1:3.5.0-2build1) [kainat] flextra platformalarının ardıcıllığı üçün çevik barkod və adapterin çıxarılması (5.0-13build1) [kainat] Hava nəqliyyatı hadisələrini izləmək üçün traektoriya modeli fml-asm (0.1-9ubuntu1) [kainat] kiçik bölgələrdə Illumina qısa oxunuşlarının yığılması üçün alət (1:0.9.18+r243-6) [kainat] Müxtəlif sonlu dövlət avtomatlarının qurulması üçün alətlər foma-bin (1:0.9.18+r243-6) [kainat] Foma forması üçün keçid paketi (4.2.1+git20200217-1) [kainat] Simvolik manipulyasiya sistemi fractalnow (0.8.2-4build1) [kainat] Sürətli, qabaqcıl fraktal generator pulsuz42-nologo (1.4.77-1.2build1) [kainat] Free42 HP-42S pulsuz kalkulyatorun (1.3.2-2) yenidən tətbiqidir [kainat] Bayes haplotip əsaslı polimorfizmin kəşfi və genotipləmə freecad (0.18.4+dfsg2-1ubuntu4) [kainat] Genişləndirilə bilən Açıq Mənbəli CAx proqramı freecad-ümumi (0.18.4+dfsg2-1ubuntu4) [kainat] Genişlənən Açıq Mənbəli CAx proqramı - ümumi fayllar freecad-python3 (0.18.4+dfsg2-1ubuntu4) [kainat] Genişləndirilə bilən Açıq Mənbəli CAx proqramı - Python 3 ikili pulsuzcad-iş vaxtı (0.18.4+dfsg2-1ubuntu4) [kainat] Genişləndirilə bilən Açıq Mənbəli CAx proqramı - işləmə faylları pulsuz əlaqə (1.0.21-7build1) [kainat] sürətli zülal əlaqə proqnozlaşdıran qurbağa (0.15-1build2) [kainat] təbii dillər üçün tagger və parser (işləmə vaxtı) frogdata (0.16-1) [kainat] Frog fsa (1.15.9+dfsg-4build1) üçün məlumat faylları [kainat] Zülal, RNT və ya DNT ardıcıllığının sürətli statistik uyğunlaşdırılması fsl-5.0-core (5.0.8-6ubuntu2) [multiverse] FMRI, MRI və DTI beyin görüntüləmə fsl-core (5.0.8-6ubuntu2) üçün analiz alətləri [multiverse] FSL fsm-lite (1.0-3build1) ən son versiyası üçün metapaket [kainat] tezlik əsaslı string mining (lite) ftools-fv (5.5+dfsg-2build2) [kainat] FITS formatlı fayllara baxmaq və redaktə etmək üçün alət ftools-pow (5.5+dfsg-2build2) [kainat] Əyrilərin planlaşdırılması və təsvirin göstərilməsi interfeysi alətləri (1.4.7-4) [kainat] Minimal alış FITS kommunal paketi fxt alətləri (0.3.9-3) [kainat] Çox yivli izləmə kitabxanası g3data (1:1.5.3-2.1build1) [kainat] skan edilmiş qrafiklərdən məlumat çıxarmaq gabedit (2.5.0-1) [kainat] Ab Initio paketləri galileo (0.5.1-6) üçün qrafik istifadəçi interfeysi [kainat] Fitbit cihazını Fitbit veb xidməti galileo-daemon (0.5.1-6) ilə təhlükəsiz sinxronizasiya etmək üçün yardım proqramı [kainat] Fitbit cihazını təhlükəsiz sinxronizasiya etmək üçün proqram - daemon gamgi (0.17.3-2) [kainat] Ümumi Atomistik Modelləşdirmə Qrafik İnterfeysi (GAMGI) gamgi-data (0.17.3-2) [kainat] Ümumi Atomistik Modelləşdirmə Qrafik İnterfeysi (məlumat) garli (2.1-3build1) [kainat] maksimum ehtimallı sarımsaq nümunələrindən istifadə edərək molekulyar ardıcıllıq məlumatlarının filogenetik təhlili (2.1-3build1) [kainat] molekulyar ardıcıllıq məlumatlarının filogenetik təhlili (nümunələr) garli-mpi (2.1-3build1) [kainat] maksimum ehtimallı (MPI) sarımsaqdan istifadə edərək molekulyar ardıcıllıq məlumatlarının filogenetik təhlili (1.6-3) [kainat] qaz biomolekulları üçün vizuallaşdırma proqramı (0.0.r19-5) [kainat] genom bolluğu oxşarlığının korreksiyası gatb-core (1.4.1+git20191209.9398f28+dfsg-2) [kainat] De-Bruijn qrafik gatb-core-testdata (1.4.1+git20191209.9398f28+dfsg-2) ilə Genom Analizi Alətlər qutusu [kainat] De-Bruijn qrafiki ilə Genom Analizi Alətlər qutusu (test məlumatları) gausssum (3.0.2-2) [kainat] Gaussian, GAMESS və s. çıxış gazebo9 (9.12.0+dfsg-1build2) təhlil edin və göstərin [kainat] Açıq Mənbə Robotik Simulyatoru - Binaries gazebo9-ümumi (9.12.0+dfsg-1build2) [kainat] Open Source Robotics Simulator - Paylaşılan fayllar gazebo9-plugin-base (9.12.0+dfsg-1build2) [kainat] Open Source Robotics Simulator - əsas plug-ins gbrowse (2.56+dfsg-8) [kainat] GMOD Ümumi Genom Brauzeri gbrowse-calign (2.56+dfsg-8) [kainat] CAlign köməkçisi gbrowse-data (2.56+dfsg-8) [kainat] GBrowse gbutils (5.7.1-1) istifadə etmək üçün nümunə data [kainat] komanda xətti econometrics gchempaint (0.14.17-3) üçün utilitlər [kainat] GNOME2 masa üstü gcrystal üçün 2D kimyəvi strukturlar redaktoru (0.14.17-3) [kainat] yüngül kristal strukturların vizualizatoru gcu-bin (0.14.17-3) [kainat] GNOME kimya proqramları (köməkçi proqramlar) gcx (1.3-1.1build1) [kainat] astronomik təsvirlərin işlənməsi və fotometriya gtk+ tətbiqi gdal-bin (3.0.4+dfsg-1build3) [kainat] Geoməkan Məlumatlarının Abstraksiya Kitabxanası - Kommunal proqramlar gdal-data (3.0.4+dfsg-1build3) [kainat] Geoməkan Məlumat Abstraksiya Kitabxanası - Məlumat faylları gdis (0.90-5build1) [kainat] molekulyar və kristal model görüntüləyicisi gdis-data (0.90-5build1) [kainat] molekulyar və kristal model görüntüləyicisi (məlumat faylları) gdl-mpfit (1.85+2017.01.03-4) [kainat] GDL gdpc (2.2.5-10) üçün möhkəm qeyri-xətti ən kiçik kvadratlar əyrisi uyğunluğu [kainat] molekulyar dinamik simulyasiyaların vizualizatoru gdpc-nümunələr (2.2.5-10) [kainat] gdpc proqramı geant321 (1:3.21.14.dfsg-11build4) üçün nümunə faylları [kainat] [Fizika] Hissəcik detektorunun təsviri və simulyasiya aləti geant321-data (1:3.21.14.dfsg-11build4) [kainat] [Fizika] GEANT 3.21 detektor simulyatoru üçün verilənlər (2.0.0-1build1) [kainat] Dövri Cədvəl görüntüləyicisi gemma (0.98.1+dfsg-1) [kainat] Genom-geniş Effektiv Qarışıq Model Assosiasiyası gemma-doc (0.98.1+dfsg-1) [kainat] GEMMA genometri üçün nümunə qovluq (4.0+git20180508.a9c14a6+dfsg-1) [kainat] k-mer siyahıları genomreader (1.7.3+dfsg-5) üzərində dəst əməliyyatları yerinə yetirmək üçün alət dəsti [kainat] gen strukturu proqnozlarını hesablamaq üçün proqram aləti genometools (1.6.1+ds-2) [kainat] çox yönlü genom analizi alət dəsti genometools-ümumi (1.6.1+ds-2) [kainat] GenomeTools incə (1.9+cvs20100605+dfsg1-8build1) üçün paylaşılan məlumat faylları [multiverse] geographiclib-tools (1.50.1-1build1) genetik klonlaşdırma planı üçün paketkainat] Bəzi geodeziya problemləri həll etmək üçün C++ kitabxanası -- alətlər geotiff-bin (1.5.1-2) [kainat] GeoTIFF (coğrafi cəhətdən aktiv TIFF) kitabxanası -- alətlər əldə edilən verilənlər (0.2-3) [kainat] xarici verilənlər bazalarının idarə edilməsi gff2aplot (2.0-11) [kainat] PostScript gff2ps (0.98l-2)-də genomik ardıcıllıqlar üçün cüt-müdrik düzülmə qrafikləri [kainat] gffread (0.11.7-2) GFF fayllarından PostScript qrafik çıxışını istehsal edir [kainat] GFF/GTF format çevrilmələri, region filtrasiyası, FASTA ardıcıllığının çıxarılması gfsview (20121130+dfsg-6) [kainat] Gerris simulyasiya faylları üçün qrafik görüntüleyici gfsview-batch (20121130+dfsg-6) [kainat] Gerris simulyasiya faylları üçün görüntüləyicinin toplu versiyası ghkl (5.0.0.2569-1build1) [kainat] difraktometr hesablama nəzarət tətbiqi ghmm (0.9

rc3-2ubuntu2) [kainat] Ümumi Gizli-Markov-Model kitabxanası - alətlər giella-core (0.1.1

r129227+svn121148-2ubuntu1) [kainat] Giellatekno dil paketləri yaratmaq üçün GTCORE faylları giella-sme (0.0.20150917

r121176-3) [kainat] Şimali Saami giella-sme-dev üçün Giellatekno tək dil datası (0.0.20150917

r121176-3) [kainat] Şimali Saami üçün Giellatekno tək dil datası (dev əlavələri) ginga (3.0.0-1) [kainat] Astronomik şəkil görüntüləyicisi ginkgocadx (3.8.8-3build1) [kainat] Tibbi Təsvir Proqramı və tam DICOM Viewer glam2 (1064-8) [kainat] boşluqlu zülal motivləri düzlənməmiş ardıcıllıqlardan yapışqan (0,15,5+dfsg-1) [kainat] Əlaqəli məlumat vizuallaşdırması gmap (04-08-2020+ds1-1) [kainat] mRNA və qısa oxunuş gmt (6.0.0+dfsg-1build2) üçün birləşdirilmiş və SNP-tolerant uyğunlaşma [kainat] Ümumi Xəritəçəkmə Alətləri gmt-common (6.0.0+dfsg-1build2) [kainat] Ümumi Xəritəçəkmə Alətləri - Memarlıqdan asılı olmayan fayllar gmt-dcw (1.1.4-2) [kainat] GMT gmt-gshhg (2.3.7-4) üçün Dünyanın Rəqəmsal Diaqramı (DCW) [kainat] Qlobal Öz-özünə ardıcıl İerarxik Yüksək Rezolyusiyalı Coğrafiya (GSHHG) gmt-gshhg-full (2.3.7-4) [kainat] Ümumi Xəritəçəkmə Alətləri üçün tam ayırdetmə sahil xətləri gmt-gshhg-high (2.3.7-4) [kainat] Ümumi Xəritəçəkmə Alətləri üçün yüksək rezolyusiyaya malik sahil xətləri gmt-gshhg-low (2.3.7-4) [kainat] Ümumi Xəritəçəkmə Alətləri gnuastro (0.11-1build1) üçün aşağı rezolyusiyaya malik sahil xətləri [kainat] GNU Astronomiya Utilities proqramları gpaw (20.1.0-2build1) [kainat] DFT və proyektorla gücləndirilmiş dalğa metodu daxilində gpaw-data (0.9.20000-2) [kainat] gpaw datasets/setups gperiodic (3.0.3-1) [kainat] dövri cədvəl tətbiqi gpx (2.5.2-4) [kainat] Gcode-dan x3g-ə çevrilmə post prosessoru gr-fcdproplus (3.8

20190817-3build3) [kainat] GNU Radio grabix (0.1.7-2build1) üçün Funcube Dongle Pro Plus nəzarətçisi [kainat] BGZF fayllarına təsadüfi daxil olmaq üçün alətdir (3:2.2.1-2build3) [kainat] Yer elmləri məlumatı üçün Şəbəkə Təhlili və Ekran Sistemi (1.1.3-2) [kainat] taksonomik və filogenetik ağacların dairəvi təsvirləri (7.8.2-1build3) [kainat] Coğrafi Resursların Təhlili Dəstək Sistemi (GRASS GIS) ot nüvəsi (7.8.2-1build3) [kainat] GRASS GIS əsas komponentləri ot-doc (7.8.2-1build3) [kainat] GRASS GIS istifadəçi sənədləri ot-gui (7.8.2-1build3) [kainat] GRASS GIS qrafik istifadəçi interfeysləri gravit (0.5.1+dfsg-3) [kainat] vizual olaraq heyrətamiz cazibə simulyatoru gravit-data (0.5.1+dfsg-3) [kainat] Gravit grinder üçün məlumat faylları (0.5.4-5) [kainat] Çox yönlü ov tüfəngi və amplikon ardıcıllığı oxumaq simulyatoru gromaks (2020.1-1) [kainat] Molekulyar dinamika simulyatoru, tikinti və analiz alətləri ilə gromaks-data (2020.1-1) [kainat] GROMACS molekulyar dinamika sim, verilənlər və sənədlər gromacs-mpich (2020.1-1) [kainat] Molekulyar dinamika sim, MPICH paralelləşməsi üçün ikili sistemlər gromaks-openmpi (2020.1-1) [kainat] Molekulyar dinamika sim, OpenMPI paralelləşdirmə gubbinləri üçün ikili sistemlər (2.3.5-1) [kainat] genom ardıcıllığının filogenetik təhlili gvb (1.4-1.1) [kainat] 1 və 2 ölçülü vibrasiyaların vizual simulyatoru gwama (2.2.2+dfsg-2build1) [kainat] Genom Geniş Assosiasiyası Meta Təhlili gwyddion (2.55-3) [kainat] Skanlayıcı Zond Mikroskopiyası vizuallaşdırma və analiz aləti gwyddion-common (2.55-3) [kainat] Gwyddion SPM analiz aləti gyoto (1.4.4-3) üçün arxitekturadan asılı olmayan fayllar [kainat] Ümumi relativistik geodeziya inteqrasiyası və şüa izləmə gyoto-bin (1.4.4-3) [kainat] Ümumi relativistik şüa izləmə komanda xətti interfeysi h5utils (1.13.1-3build1) [kainat] HDF5 faylları vizuallaşdırma alətləri harminv (1.4.1-2build1) [kainat] mürəkkəb tezliklərin və amplitudaların zaman sıralarının yığım alətlərindən çıxarılması (1.3-4build2) [kainat] istinadla sıxılmış genomik çoxlu hizalamalar üçün arxivləşdirmə və sonrakı emal hdf-kompas (0.7)

b8-2) [kainat] HDF5 və əlaqəli formatlar üçün görüntüləyici hdf5-helpers (1.10.4+repack-11ubuntu1) [kainat] İerarxik Məlumat Format 5 (HDF5) - Köməkçi alətlər hdf5-alətləri (1.10.4+repack-11ubuntu1) [kainat] İerarxik Məlumat Format 5 (HDF5) - İcra alətləri herisvm (0.8.2-1) [kainat] təsnifat alqoritmləri üçün maşın öyrənmə vasitələri hfst (3.15.1-2build3) [kainat] Helsinki Sonlu Dövlət Transducer Texnologiyası hfst-ospell (0.5.0-2build2) HFST hhsuite (3.2.0-2build1) əsasında Orfoqrafiya yoxlayıcı kitabxana və alət [kainat] HMM-HMM uyğunlaşdırılması hhsuite-data (3.2.0-2build1) əsasında həssas protein ardıcıllığının axtarışı [kainat] HMM-HMM uyğunlaşmasına (məlumat) əsaslanan həssas protein ardıcıllığının axtarışı (2.0a-3build2) [kainat] Illumina oxu menteşesinin real vaxtda hizalanması (0.5.0-6) [kainat] menteşe hisat2 (2.1.0-4) əsasında uzun müddət oxunan genom assembler [kainat] qısa nukleotidin qrafik əsasında düzülməsi bir çox genomları oxuyur hmmer (3.3+dfsg2-1) [kainat] zülal ardıcıllığının təhlili üçün profil gizli Markov modelləri hmmer2 (2.3.2+dfsg-6) [kainat] zülal ardıcıllığının təhlili üçün profil gizli Markov modelləri hmmer2-pvm (2.3.2+dfsg-6) [kainat] PVM (Paralel Virtual Maşın) ilə HMMER proqramları hodie (1.5.0-1) dəstəkləyir [kainat] tarixi Latın hpcc (1.5.0-2) hərfində çap edir [kainat] HPC Challenge benchmark htcondor (8.6.8

dfsg.1-2ubuntu1) [kainat] paylanmış iş yükünün idarə edilməsi sistemi hyphy-ümum (2.5.1+dfsg-3) [kainat] Phylogenies (ümumi fayllar) hyphy-mpi (2.5.1+dfsg-3) istifadə edərək hipotez testi [kainat] Phylogenies (MPI versiyası) hyphy-pt (2.5.1+dfsg-3) istifadə edərək hipotez testi [kainat] Phylogenies (pthreads versiyası) idba (1.1.3-5build1) istifadə edərək hipotez testi [kainat] iterativ De Bruijn Qrafik qısa oxunan montajçılar igdiscover (0.11-3) [kainat] yeni V genlərini tapmaq üçün antikor repertuarlarını təhlil edir igor (1.3.0+dfsg-1build1) [kainat] igv (2.4.17+dfsg-1) ardıcıllığından V(D)J rekombinasiya proseslərini çıxarır [multiverse] İnteqrativ Genomics Viewer imagej (1.52r-1) [kainat] Görüntülərin mikroskopiyasına diqqət yetirən şəkil emal proqramı (1.1.9h-1build1) [kainat] Şəkillərə baxmaq və təhlil proqramı silinməz (1.03-4build1) [kainat] indigo-utils bioloji təkamülünün güclü və çevik simulyatoru (1.2.3-3build1) [kainat] Üzvi Kimya Alət dəsti Utilities infernal (1.1.3-4) [kainat] RNT-nin ikincili struktur düzülüşünə dair nəticə (0.1.9.2-1) [kainat] kinematik geri reaksiya və orta miqyas amili təkamülü inkscape-speleo (1.8-4) [kainat] Sorğuların çəkilməsinə kömək etmək üçün Inkscape plagini inkscape-survex-export (1.0-3) [kainat] Çap edilmiş sorğuları rəqəmləşdirmək üçün Inkscape plaqini ipig (0.0.r5-3) [kainat] PSM-lərin genom brauzer vizualizasiyasına inteqrasiyası iqtree (1.6.12+dfsg-1build1) [kainat] efektiv filogenetik proqram maksimum ehtimalla iraf (2.16.1+2018.11.01-3) [kainat] Şəklin Azaldılması və Təhlil Mexanizmi iraf-dev (2.16.1+2018.11.01-3) [kainat] Şəklin Azaldılması və Təhlil Mexanizmi (inkişaf faylları) iraf-fitsutil (2018.07.06-4) [kainat] IRAF iraf-mscred (5.05+2018.07.09-1build2) üçün FITS kommunal proqramları [kainat] IRAF iraf-noao (2.16.1+2018.11.01-3) üçün CCD mozaika azaltma paketi [kainat] IRAF NOAO məlumatların azaldılması paketi iraf-noao-dev (2.16.1+2018.11.01-3) [kainat] IRAF NOAO məlumatların azaldılması paketi (inkişaf faylları) iraf-rvsao (2.8.3-1build2) [kainat] iraf-sptable spektrlərindən radial sürətlər əldə etmək üçün IRAF paketi (1.0)

pre20180612-1build2) [kainat] Tabular Spectra iraf-wcstools üçün IRAF paketi (3.9.5-3) [kainat] FITS təsvirinin (IRAF paketi) ismrmrd-schema (1.4.0-1build1) WCS-ni idarə edin [kainat] ISMRMRD ismrmrd-tools (1.4.0-1build1) üçün sxem [kainat] ISMRMRD itksnap (3.6.0-5build1) üçün komanda xətti alətləri [kainat] 3D təsvirlərdə strukturların yarı avtomatik seqmentasiyası iva ​​(1.0.9+ds-10) [kainat] iterativ virus ardıcıllığı assembler jaligner (1.0+dfsg-6) [kainat] Smith-Waterman alqoritmi ilə Gotoh's təkmilləşdirilməsi jblas (1.2.4-2build1) [kainat] Java meduza üçün sürətli xətti cəbr kitabxanası (2.3.0-4build1) [kainat] DNT ardıcıllığında k-merləri saymaq meduza nümunələri (2.3.0-4build1) [kainat] DNT ardıcıllığında k-merləri saymaq (sınaq üçün nümunələr) meduza1 (1.1.11-4build1) [kainat] DNT ardıcıllığında k-merləri saymaq jemboss (6.6.0+dfsg-7ubuntu2) [kainat] EMBOSS jmodeltest (2.1.10+dfsg-8) üçün qrafik istifadəçi interfeysi [kainat] Nukleotid əvəzetmə modellərinin HPC seçimi jmol (14.6.4+2016.11.05+dfsg1-4build1) [kainat] Molecular Viewer jsamp (1.3.7-1) [kainat] VO jube üçün Java Sadə Proqram Mesajlaşma Protokolu aləti (2.2.2-1) [kainat] JUBE Mühitin Qiymətləndirilməsi Julia (1.4.1+dfsg-1) [kainat] texniki hesablama üçün yüksək performanslı proqramlaşdırma dili julia-common (1.4.1+dfsg-1) [kainat] texniki hesablamalar üçün yüksək performanslı proqramlaşdırma dili (ümumi fayllar) jupyter-notebook (6.0.3-2) [kainat] Jupyter interaktiv notebook kalign (1:2.03+20110620-5) [kainat] Qlobal və mütərəqqi çoxsaylı ardıcıl düzülmə kallisto (0.46.1+dfsg-2build1) [kainat] optimal yaxın RNT-Seq kəmiyyət kallisto-nümunələr (0.46.1+dfsg-2build1) [kainat] optimala yaxın RNT-Seq kəmiyyəti (nümunə məlumat) kalzium (4:19.12.3-0ubuntu1) [kainat] dövri cədvəl və kimya alətləri kalzium-data (4:19.12.3-0ubuntu1) [kainat] Kalzium kaptive (0.7.0-2) üçün məlumat faylları [kainat] Klebsiella genom birləşmələri üçün K və O tipləri haqqında məlumat əldə edin kaptive-data (0.7.0-2) [kainat] Klebsiella genom birləşmələri üçün kaptive üçün istinad məlumatları kaptive-məsələn (0.7.0-2) [kainat] Klebsiella genom birləşmələri üçün kaptive üçün nümunə data khmer-common (2.1.2+dfsg-6build2) [kainat] khmer layihə alətləri üçün ümumi fayllar king-probe (2.16.160404+git20180613.a09b012-1) [kainat] Protein interatomik qablaşdırma kissplice (2.4.0-p1-5ubuntu1) qiymətləndirin və görüntüləyin [kainat] RNT-seq data kleborate (1.0.0-3) polimorfizmlərin müxtəlif növlərinin aşkarlanması [kainat] Klebsiella genom birləşmələrinin kleborate-nümunələrini ekranlaşdırmaq üçün alət (1.0.0-3) [kainat] Klebsiella genom birləşmələrini ekranlaşdırmaq üçün alət (nümunə məlumat) klustakwik (2.0.1-1build2) [kainat] nümunələrin (sünbüllərin) klasterlərə avtomatik çeşidlənməsi kma (1.2.21-1) [kainat] genomik ardıcıllıqları xam oxunuşlara birbaşa lazımsız verilənlər bazası ilə əlaqələndirmək kmc (2.3+dfsg-7build1) [kainat] kmerləri genomik ardıcıllıqda saymaq kmerrezistans (2.2.0-1) [kainat] xəritələnmiş genləri WGS nümunələrinin proqnozlaşdırılan növləri ilə əlaqələndirir (0.6.2+939)

dfsg-1build1) [kainat] semantik veb kraken (1.1.1-1build1) üçün cədvəl əsaslı təsvir məntiqi əsaslandırıcısı [kainat] qısa DNT ardıcıllığına taksonomik etiketlərin təyin edilməsi kraken2 (2.0.8)

beta-1build1) [kainat] dəqiq k-mer uyğunluqlarından istifadə edən taksonomik təsnifat sistemi kst (2.0.8-3build4) [kainat] elmi məlumatların planlaşdırılması aləti kstars (5:3.4.1-1) [kainat] masa üstü planetarium, müşahidə planlaşdırma və teleskop nəzarət kstars-data (5:3.4.1-1) [kainat] KStars masa üstü planetarium kstars-data-extra-tycho2 (1.1r1-9.1) üçün məlumat faylları [kainat] KStars kxterm (20061220+dfsg3-4.4build1) üçün Tycho-2 ulduz kataloqu [kainat] CERNLIB məlumat təhlili dəsti - KUIP terminal emulyatoru lagan (2.0-5build1) [kainat] yüksək parametrləşdirilə bilən ikili qlobal genom ardıcıllığı düzləşdirici lamarc (2.1.10.1+dfsg-4build1) [kainat] Random Coalescence lambda-align (1.0.3-6) istifadə edərək Metropolis Alqoritmi ilə Ehtimal Analizi [kainat] Kütləvi Bioloji Məlumatlar üçün Yerli Düzləşdirici lambda-align2 (2.0.0-2build1) [kainat] Kütləvi Bioloji MəlumatA üçün Yerli Düzləşdirici - v2 lampalar (20191120+dfsg1-2build2) [kainat] Molekulyar Dinamika Simulyatoru son hizalama (1060-1) [kainat] bioloji ardıcıllığın genom miqyaslı müqayisəsi lefse (1.0.8-3) [kainat] orqanizmlərin xüsusiyyətlərini, təbəqələrini, taksonomik vahidlərini, libadios-bin genlərini müəyyən edir (1.13.1-20) [kainat] Simulyasiyalar üçün ADIOS Uyğunlaşan IO sistemi - ikili libadios-nümunələr (1.13.1-20) [kainat] ADIOS Adaptable IO sistemi libarb (6.0.6-4build1) üçün nümunələr [multiverse] filogenetik ardıcıllıq təhlili paketi - libatlas-ecmwf-utils kitabxanaları (0.19.0-8build1) [kainat] Rəqəmsal hava proqnozu və iqlim modelləşdirmə kitabxanası - kommunal proqramlar libball1.5-data (1.5.0+git20180813.37fc53c-4build2) [kainat] Biokimyəvi Alqoritmlər Kitabxanası (məlumat faylları) libbio-db-hts-perl (3.01-3) [kainat] HTS kitabxanasına Perl interfeysi libbio-tools-phylo-paml-perl (1.7.3-2) [kainat] PAML paketinə Biooperl interfeysi libbio-tools-run-alignment-clustalw-perl (1.7.4-1) [kainat] Clustal W libbio-tools-run-alignment-tcoffee-perl (1.7.4-1) üçün Biooperl interfeysi [kainat] T-Coffee libbiojava-java üçün Biooperl interfeysi (1:1.7.1-8) [kainat] Java API bioloji məlumatlara və tətbiqlərə (standart versiya) libbiojava-java-demolara (1:1.7.1-8) [kainat] BioJava libbiojava1.7-java (1:1.7.1-8) üçün nümunə proqramlar [kainat] Bioloji məlumatlar və proqramlar üçün Java API (versiya 1.7) libcamitk4 (4.1.2-4build1) [kainat] Kompüter Dəstəkli Tibbi Müdaxilə Alət Dəsti - iş vaxtı libcassie1v5 (1.0.9-2build1) [kainat] axtarış alqoritmlərini həyata keçirən kitabxana libcg3-1 (1.3.1-2build3) [kainat] CG-3 libclhep2.1v5 (2.1.4.1+dfsg-1build1) üçün icra müddəti [kainat] CLHEP: Yüksək Enerji Fizikası üçün Sinif Kitabxanası libdivsufsort3 (2.0.1-4) [kainat] sürətli şəkilçi massiv tikinti libeccodes-data (2.16.0-1) [kainat] GRIB və BUFR kodlaşdırma/kodlaşdırma proqram kitabxanası - data libeckit-utils (1.4.7-7build1) [kainat] ECMWF alətləri və proqramları üçün C++ alət dəsti - inkişaf faylları libej0 (4.6.2-1) [kainat] elmi təcrübələrin inkişafı üçün aparat və proqram təminatı çərçivəsi libgenometools0 (1.6.1+ds-2) [kainat] çox yönlü genom analizi kitabxanası libgfsgl0 (20121130+dfsg-6) [kainat] Gerris simulyasiya faylları üçün qrafik görüntüleyici. Paylaşılan kitabxana libghemical-data (3.0.0-4.2build3) [kainat] Molekulyar Modelləşdirmə Kitabxanası (məlumat faylları) libgiac0 (1.5.0.85+dfsg1-3) [kainat] Kompüter Cəbr Sistemi C++ kitabxanası libgtkdatabox0-glade (1:0.9.3.1-1) [kainat] Böyük miqdarda ədədi məlumatı göstərmək üçün Gtk+ kitabxanası (glade API) libgtkdatabox0-libglade (1:0.9.3.1-1) [kainat] Böyük miqdarda ədədi məlumatı göstərmək üçün Gtk+ kitabxanası (glade lib) libhdf5-jni (1.10.4+repack-11ubuntu1) [kainat] libhdf5-java libismrmrd1.3 (1.4.0-1build1) tərəfindən istifadə edilən yerli kitabxana [kainat] ISMRM Raw Data formatı (ISMRMRD) liblammps-dev (20191120+dfsg1-2build2) [kainat] Molekulyar Dinamika Simulyatoru (dev faylları) liblammps0 (20191120+dfsg1-2build2) [kainat] Molecular Dynamics Simulator (ortaq kitabxana) libligggghts3 (3.8.0+repack1-5build1) [kainat] Açıq Mənbəli DEM Hissəcik Simulyasiya Proqramı. Paylaşılan kitabxana liblinear-alətləri (2.3.0+dfsg-3build1) [kainat] LIBLINEAR liblorene-debian1 üçün müstəqil proqramlar (0.0.0

cvs20161116+dfsg-1ubuntu6) [kainat] liblorene paylaşılan kitabxana liblorene-export-debian0 (0.0.0

cvs20161116+dfsg-1ubuntu6) [kainat] liblorene_export paylaşılan kitabxana liblorenef77-debian1 (0.0.0

cvs20161116+dfsg-1ubuntu6) [kainat] liblorenef77 paylaşılan kitabxana libmstoolkit-tools (82-6build1) [kainatKütləvi spektrometriya məlumatlarını manipulyasiya etmək üçün kitabxanalar - alətlər libncarg-bin (6.6.2-1build4) [kainat] NCAR əmr dili kitabxanası - inkişaf alətləri libncarg-data (6.6.2-1build4) [kainat] NCAR əmr dili kitabxanası - Data libngram-tools (1.3.2-3build1) [kainat] OpenGRM n-qram Dil Modelləşdirmə alət dəsti libocas-tools (0.97+dfsg-6) [kainat] OCAS həlledici libopenfoam tətbiq edən müstəqil proqramlar (1906.191111+dfsg1-2build1) [kainat] Hesablama Mayeləri Dinamiği (CFD) üçün açıq mənbə alətlər qutusu - libotb kitabxanaları (7.0.0+dfsg-2build3) [kainat] ORFEO Toolbox kitabxana metapaketi libotb-apps (7.0.0+dfsg-2build3) [kainat] ORFEO Toolbox proqramları üçün plaginlər libpluto-jpl-eph-dev (0.0)

git20180228-1.1build1) [kainat] JPL ephemeres data libpluto-lunar-dev (0.0) ilə qarşılıqlı əlaqə yaratmaq üçün inkişaf faylları

git20180825.e34c1d1-1build1) [kainat] astronomik Ay kitabxanası üçün inkişaf faylları libpwiz-tools (3.0.18342-2) [kainat] ProteoWizard komanda xətti alətləri libqgis-customwidgets (3.10.4+dfsg-1ubuntu2) [kainat] Qt Designer libqtpropertybrowser4 (4.1.2-4build1) üçün QGIS xüsusi vidjetləri [kainat] Qt Property Browser Library - iş vaxtı librasterlite2-1 (1.1.0)

rc0+devel1-2build1) [kainat] SpatiaLite DBMS librsl1 (1.43-1.2build1) istifadə edərək böyük rastr əhatələri üçün kitabxana [kainat] TRMM Radar Proqram Kitabxanası libsilo-bin (4.10.2.real-7) [kainat] Libsilo fayllarını manipulyasiya etmək üçün utilitlər libsqlite3-mod-virtualpg (2.0.0)

rc0-1) [kainat] Həm SQLite, həm də SpatiaLite libsquizz üçün yüklənə bilən dinamik genişləndirmə (0.99d+dfsg-2) [kainat] Squizz genetik ardıcıllıq çeviricisi libssm-bin (1.4.0-1build1) tərəfindən istifadə edilən çevirmə libləri [kainat] makromolekulyar superpozisiya kitabxanası - binaries libstxxl1v5 (1.4.1-3build1) [kainat] Əlavə böyük verilənlər dəstləri üçün C++ Standart Şablon Kitabxanası libvcflib-tools (1.0.1+dfsg-3) [kainat] VCF fayllarının təhlili və manipulyasiyası üçün C++ kitabxanası (alətlər) libvdjtools-java (1.2.1+git20190311-1) [multiverse] vdjtools libxy-bin Java kitabxanası (1.3-1.1build2) [kainat] xylib - kommunal xidmətlər libyade (2020.01a-6build2) [kainat] Diskret elementlərin modelləşdirilməsi üçün platforma. Kitabxana işıqları (3.8.0+repack1-5build1) [kainat] Açıq Mənbəli DEM Hissəcik Simulyasiya Proqramı. litl-alətlər (0.1.9-7) [kainat] Yüngül İzlər Kitabxanası - alətlər logol (1.7.9-2) [kainat] Logol dili logol-bin (1.7.9-2) istifadə edərək naxış uyğunlaşdırma aləti [kainat] Logol dili loki (2.4.7.4-10) istifadə edərək naxış uyğunlaşdırma aləti [kainat] Ümumi damazlıqlar üzrə MCMC əlaqə təhlili loki-doc (2.4.7.4-10) [kainat] Ümumi nəsillər üzrə MCMC əlaqə təhlili (PS manual) looptools (2.8-1build3) [kainat] Bir dövrəli Feynman Diaqramının İnteqral Qiymətləndiricisi (0.0.0)

cvs20161116+dfsg-1ubuntu6) [kainat] ədədi nisbilik üçün çərçivə lorene-codes-src (0.0.0

cvs20161116+dfsg-1ubuntu6) [kainat] LORENE əsaslı kodların mənbə faylları ltrsift (1.0.2-8) [kainat] LTR retrotranspozonlarının lttoolbox-dev (3.5.1-2build2) nin sonrakı işlənməsi və təsnifatı [kainat] Lttoolbox lucy üçün inkişaf alətləri və kitabxana (1.20-1) [kainat] DNT ardıcıllığının keyfiyyəti və vektor kəsmə aləti lutefisk (1.0.7+dfsg-4build1) [kainat] peptid CID spektrlərinin lxi-alətlərinin de novo şərhi (1.21-1build1) [kainat] Alətlər üçün LAN genişləndirmələri (LXI) proqram interfeysi maffilter (1.3.1+dfsg-1build1) [kainat] Çoxlu Alignment Format maffilter nümunələrində genom düzülməsini proses edin (1.3.1+dfsg-1build1) [kainat] Çoxlu Alignment Formatında (nümunə verilənlər) mafft (7.453-1) ilə genomun uyğunlaşdırılması prosesikainat] Amin turşusu və ya nukleotid ardıcıllığının xəritə zədələnməsi üçün çoxlu uyğunlaşdırma proqramı (2.2.0+dfsg-1) [kainat] qədim DNT ardıcıllıqlarında zərər nümunələrinin izlənilməsi və ölçülməsi mapsembler2 (2.2.4+dfsg-3build2) [kainat] bioinformatika məqsədli montaj proqramı maq (0.7.1-8build1) [kainat] qısa sabit uzunluqlu polimorfik DNT ardıcıllığını xəritələr maqview (0.2.5-9build1) istinad ardıcıllığına oxuyur [kainat] Qısa gen ardıcıllığı mash (2.2.2+dfsg-1build1) üçün qrafik oxunuş düzülməsinə baxıcı [kainat] MinHash matlab-gdf (0.1.3-3ubuntu2) istifadə edərək sürətli genom və metagenom məsafəsinin qiymətləndirilməsi [multiverse] GDF üçün IO kitabxanası -- Matlab interfeysi maude (2.7-2build2) [kainat] yüksək performanslı məntiqi çərçivə bənövşəyi düzləndirici (2.4.0+4736-2build1) [kainat] çoxlu genom düzülüşü mayavi2 (4.7.1-2build1) [kainat] 2-D və 3-D data mbt (3.4-1build1) üçün elmi vizuallaşdırma paketi [kainat] yaddaş əsaslı tagger-generator və tagger mbtserver (0.12-1build1) [kainat] MBT tagger meep (1.12.0-2build2) üçün server genişləndirmələri [kainat] FDTD simulyasiyası üçün proqram paketi meep-mpi-default (1.12.0-2build2) [kainat] FDTD simulyasiyası üçün proqram paketi, paralel (OpenMPI) versiyası meep-openmpi (1.12.0-3build2) [kainat] FDTD simulyasiyası üçün proqram paketi, paralel (OpenMPI) versiyasının əriməsi (5.2.0-1) [kainat] nuklein turşusu dupleks metaphlan2 ərimə temperaturunu hesablayın (2.9.22-1) [kainat] Metagenomik Filogenetik Analiz metaphlan2-məlumat (2.6.0+ds-4) [kainat] Metagenomik Filogenetik Analiz metastudent (2.0.1-8) üçün məlumat paketi [kainat] protein ardıcıllığı metastudent-məlumatlarından Gen Ontologiyası şərtlərinin proqnozlaşdırıcısı (2.0.1-4) [kainat] zülal ardıcıllığından Gen Ontologiyası şərtlərinin proqnozlaşdırıcısı - məlumat faylları metastudent-data-2 (1.0.0-4) [kainat] zülal ardıcıllığından Gen Ontologiyası şərtlərinin proqnozlaşdırıcısı - data #2 metview (5.7.5-1) [kainat] İnteraktiv verilənlərin vizuallaşdırılması və təhlili mühiti, metview-data (5.7.5-1) [kainat] Metview məlumat təhlili mühiti üçün lazım olan məlumatlar mhap (2.1.3+dfsg-2) [kainat] uzun müddət oxunan üst-üstə düşən mia-doctools (2.4.6-5build3) aşkar etmək üçün lokallığa həssas heshing [kainat] İş vaxtı sənəd yaratma mia-alətləri üçün köməkçi skriptlər (2.4.6-5build3) [kainat] Boz miqyaslı təsvirin işlənməsi üçün əmr xətti alətləri mia-viewit (1.0.5-2build1) [kainat] MIA mialmpick (0.2.14-2) istifadə edərək yaradılmış 3D məlumat dəstləri üçün Viewer proqramı [kainat] Microbegps (1.0.0-5) 3D həcm məlumat dəstlərində əlamətdar nişanı seçmək üçün alətlərkainat] metagenom data microbiomeutil (20101212+dfsg1-3) üçün kəşfiyyatçı taksonomik profilləşdirmə vasitəsi [kainat] Microbiome Analysis Utilities microbiomeutil-data (20101212+dfsg1-3) [kainat] Mikrobiomeutil alətləri mikrohopu (4.6.2-1) tərəfindən istifadə edilən istinad 16S ardıcıllığı və NAST hizalamaları [kainat] mikrokontroller minc-alətlərini öyrənmək üçün aparat və proqram təminatı çərçivəsi (2.3.00+dfsg-3build2) [kainat] MNI tibbi görüntü formatı alətləri minia (1.6906-2) [kainat] qısa oxunan bioloji ardıcıllıq assembler miniazmı (0.3+dfsg-1) [kainat] uzun səs-küylü DNT ardıcıllığı üçün ultrafast de novo assembler minimac4 (1.0.2-2build1) oxuyur [kainat] Dövlət Məkanının Azaldılması HMM mini xəritəsi (0.2-4) əsasında Sürətli İmputasiya [kainat] DNT kimi uzun biosekansların təxmini xəritələşdirilməsi üçün alət minimap2 (2.17+dfsg-2) [kainat] genomik və birləşdirilmiş nukleotid ardıcıllığı üçün çox yönlü cüt düzləşdirici minisat (1:2.2.1-5build2) [kainat] Sürətli və yüngül SAT həlledici minisat+ (1.0-4build1) [kainat] psevdo-Boolean məhdudiyyətləri üçün həlledici minisat2 (1:2.2.1-5build2) [kainat] minisat minisat2 виртуальный paket üçün keçid paketi, preдоставляемый minisat mipe (1.1-7) [kainat] PCR-dən əldə edilmiş məlumatları saxlamaq üçün alətlər mira-assembler (4.9.6-4build5) [kainat] Bütün Genom Ov tüfəngi və EST Ardıcıllığı Assembler mira-rfam-12s-rrna (4.9.6-4build5) [kainat] RFAM 12 rRNA verilənlər bazası mirtopunun çıxarışı (0.4.23-1) [kainat] miRNA-ları standart mirna/izomir adlandırma səhvləri ilə annotasiya edin (2.8.0-2) [kainat] FITS faylları mitools (2.0.3-2build1) üzrə əsas texniki xidmət və qablaşdırma tapşırıqları [kainat] tibbi görüntü verilənlər bazası mldemos (0.5.1+git.1.ee5d11f-4) ilə əsas riyaziyyata baxın, çevirin və yerinə yetirin [kainat] Vizuallaşdırma mlpack-bin (3.2.2-3) ilə Maşın Öyrənmə Demoları (MLDemos) [kainat] intuitiv, sürətli, genişləndirilə bilən C++ maşın öyrənmə kitabxanası (ikili) mlv-smile (1.47-6) [kainat] mmseqs2 (9-d36de+ds-4) ardıcıllığında statistik əhəmiyyətli nümunələri tapın [kainat] ultra sürətli və həssas protein axtarışı və qruplaşdırılması mmseqs2-nümunələr (9-d36de+ds-4) [kainat] mmseqs2 mokasin paketi (2.02.73-2) üçün əlavə resurslar [kainat] MOnte Carlo İonlaşmış Dumanlıqların Mokasin-Bençmarklarının Simulyasiyaları (2.02.73-2) [kainat] fotoionizasiya kodu MOCASSIN mocassin-data (2.02.73-2) üçün meyarlar [kainat] fotoionizasiya kodu MOCASSIN mokasin nümunələri üçün atomik və optik məlumatlar (2.02.73-2) [kainat] Fotoionlaşdırma kodu MOCASSIN montajı üçün nümunələr (6.0+dfsg-6build3) [kainat] FITS şəkillərini mozaika montaj-gridtools-a yığmaq üçün alət dəsti (6.0+dfsg-6build3) [kainat] Montecarlo-base (20061220+dfsg3-3.1build4) şəbəkəsində montajı həyata keçirmək üçün fayllar yaradın [kainat] [Fizika] CERNLIB Monte Karlo kitabxanaları üçün ümumi fayllar montecarlo-data (20061220+dfsg3-3.1build4) [kainat] [Fizika] CERNLIB Monte Karlo kitabxanaları üçün data mopac7-bin (1.15-6ubuntu4) [kainat] Yarı empirik Kvant Kimya Kitabxanası (ikili sistemlər) morse-simulyatoru (1.4-6build1) [kainat] Multi-OpenRobot Simulation Engine morse-simulator-data (1.4-6build1) [kainat] Çox Açıq Robot Simulyasiya Mühərriki (1.42.1-1build1) [kainat] mikrobiota mpb (1.9.0-2) üzrə tədqiqat üçün ardıcıllıq təhlili paketi [kainat] MIT Fotonik-Bands mpb-mpi (1.9.0-2) [kainat] MIT Photonic-Bands, paralel (mpich) versiya mpb-scm (1.9.0-2) [kainat] MIT Photonic-Bands başlatma faylları mpgrafic (0.3.18-1build1) [kainat] N-bədənin ilkin şərtlərinin MPI versiyası qrafik paketi mpqc (2.3.1-19) [kainat] Kütləvi Paralel Kvant Kimya Proqramı mpqc dəstəyi (2.3.1-19) [kainat] Kütləvi Paralel Kvant Kimya Proqramı (dəstək alətləri) mpqc3 (0.0

git20170114-4.1) [kainat] Kütləvi Paralel Kvant Kimya Proqramı mpqc3-data (0.0

git20170114-4.1) [kainat] Kütləvi Paralel Kvant Kimya Proqramı (məlumat faylları) mptp (0.2.4-1) [kainat] tək yerli növlərin delimitasiyası mrbayes-mpi (3.2.6+dfsg-2ubuntu2) [kainat] Filogeniyanın Bayesian Nəticəsi - mpi versiyası mriconvert (1:2.1.0-4build1) [kainat] tibbi təsvir faylı çevirmə proqramı mricron (0.20140804.1

dfsg.1-3) [kainat] maqnit rezonans təsvirin çevrilməsi, baxılması və təhlili mrikron məlumatı (0.20140804.1

dfsg.1-3) [kainat] MRIcron mrs (6.0.5+dfsg-7build7) üçün məlumat faylları [kainat] Biotibbi məlumat bankları üçün Məlumat Axtarış Sistemi mrtrix3 (3.0

rc3+git135-g2b8e7d0c2-5) [kainat] diffuziya ilə çəkilmiş MRT ağ maddə traktoqrafiyası mseed2sac (2.3+ds1-1) [kainat] MiniSEED zaman seriyası məlumatlarını SAC mssstest-ə çevirin (3.0-7build1) [multiverse] Dağınıq Sklerozlu xəstələr üçün xəstəlik skorlarının normallaşdırılması msxpertsuite (5.8.6-2build1) [kainat] kütləvi spektrometriya proqram dəsti - msxpertsuite-massxpert metapaketi (5.8.6-2build1) [kainat] kütləvi spektrometriya proqram dəsti - massXpert msxpertsuite-massxpert-data-doc (5.8.6-2build1) [kainat] kütləvi spektrometriya proqram dəsti - massXpert - data və doc msxpertsuite-minexpert (5.8.6-2build1) [kainat] kütləvi spektrometriya proqram dəsti - mineXpert msxpertsuite-minexpert-data-doc (5.8.6-2build1) [kainat] kütləvi spektrometriya proqram dəsti - mineXpert - məlumat və sənəd mummer (3.23+dfsg-4build1) [kainat] Tam genomların səmərəli ardıcıl uyğunlaşdırılması munipack (0.5.11-2.1build1) [kainat] Astronomik fotometriya proqram paketi munipack-cli (0.5.11-2.1build1) [kainat] Munipack munipack nüvəsinin komanda xətti interfeysi (0.5.11-2.1build1) [kainat] Munipack munipack-gui-nin (0.5.11-2.1build1) əsas rutinləri [kainat] Munipack murasaki (1.68.6-9build2) qrafik istifadəçi interfeysi [kainat] murasaki-ümumi (1.68.6-9build2) çoxlu böyük genomlar üzrə homologiya aşkarlama vasitəsi [kainat] çoxsaylı böyük genomlar üzrə homologiya aşkarlama aləti (ümumi fayllar) murasaki-mpi (1.68.6-9build2) [kainat] çoxlu böyük genomlarda homologiya aşkarlama vasitəsi (MPI-versiya) əzələ (1:3.8.1551-2build1) [kainat] Zülal ardıcıllığının çoxlu uyğunlaşdırma proqramı musiqi-bin (1.1.16-1.1build2) [kainat] MPI üçün Çox Simulyasiya Koordinatoru -- Utilities mustang (3.2.3-3build1) [kainat] zülalların çoxsaylı struktur uyğunlaşması mustang-testdata (3.2.3-3build1) [kainat] zülalların çoxsaylı struktur uyğunlaşması, test məlumatları nanook (1.33+dfsg-1) [kainat] nanopore sequencing data nanopolish (0.11.3-1build1) üzrə hizalanmadan əvvəl və sonrakı təhlili [kainat] nanopore sıralama məlumatı üçün konsensus çağıran şəxs (20101212+dfsg1-3) [kainat] NAST əsaslı DNT uyğunlaşdırma aləti nasran (0.1.95-1build3) [multiverse] NASA Struktur Analiz Sistemi nautic (1.5-4build1) [kainat] astronaviqasiyada müşahidəçi mövqeyinin hesablanması ncbi-blast+ (2.9.0-2) [kainat] BLAST ardıcıllığı axtarış alətlərinin növbəti nəsil dəsti ncbi-blast+-legacy (2.9.0-2) [kainat] NCBI Blast köhnə zəng skripti ncbi-cn3d (3.0.20170106+dfsg1-8) [kainat] Bioloji molekullar üçün 3 ölçülü görüntüləyici ncbi-entrez-direct (12.0.20190816+ds-1) [kainat] Komanda xəttində NCBI Entrez utilitləri ncbi-epcr (2.3.12-1-8build1) [kainat] Ardıcıllıqla işarələnmiş saytların mövcudluğu üçün DNT ardıcıllığını yoxlamaq üçün alət ncbi-rrna-data (6.1.20170106+dfsg1-8) [kainat] NCBI alət dəsti ncbi-seg (0.0.20000620-5) ilə paylanmış böyük rRNA BLAST verilənlər bazası [kainat] amin turşusu ardıcıllığında aşağı kompozisiya mürəkkəbliyi olan seqmentləri maskalamaq üçün alət ncbi-tools-bin (6.1.20170106+dfsg1-8) [kainat] Biologiya proqramları üçün NCBI kitabxanaları (mətn əsaslı yardım proqramları) ncbi-tools-x11 (6.1.20170106+dfsg1-8) [kainat] Biologiya proqramları üçün NCBI kitabxanaları (X əsaslı kommunal proqramlar) ncl-ncarg (6.6.2-1build4) [kainat] NCAR Komanda Dili və NCAR qrafikası ncl alətləri (2.1.21+git20190531.feceb81-2build1) [kainat] NEXUS faylları ilə məşğul olmaq üçün alətlər ncoils (2002-7) [kainat] qıvrılmış rulonun ikincil strukturunun proqnozlaşdırılması ncview (2.1.8+ds-3build2) [kainat] NetCDF formatlı fayllar üçün X11 vizual brauzer səliqəli (2.2-1build1) [kainat] Nebular Empirik Analiz Aləti neobio (0.0.20030929-4) [kainat] amin turşusu və nukleotid ardıcıllığının düzülmələrini hesablayır netcdf-bin (1:4.7.3-1) [kainat] NetCDF fayllarını oxumaq və yazmaq üçün proqramlar neyron (7.6.3-1build4) [kainat] Neyronların hesablama modelləri üçün simulyasiya mühiti neuron-dev (7.6.3-1build4) [kainat] Neyron simulyasiya mühiti - İnkişaf faylları nexus-tools (4.4.3-4) [kainat] NeXus elmi məlumat faylı formatı - proqramlar nifti2dicom (0.4.11-1.1build1) [kainat] 3D tibbi təsvirləri DICOM 2D seriyalı nifti2dicom-data-ya çevirin (0.4.11-1.1build1) [kainat] nifti2dicom njplot (2.4-8) üçün məlumat faylları [kainat] filogenetik ağac çəkmə proqramı node-sferikmerkator (1.0.1-2) [kainat] NodeJS node-srs (0.4.8+dfsg-4ubuntu2) üçün Sferik Mercator proyeksiya dəstəyi [kainat] Node.js norsnet (1.0.17-6) üçün məkan istinad kitabxanası [kainat] zülallarda strukturlaşdırılmamış döngələri müəyyən etmək üçün alət norsp (1.0.6-4) [kainat] qeyri-müntəzəm ikincili strukturun proqnozlaşdırıcısı numdiff (5.9.0-1) [kainat] Oxşar faylları rəqəmsal sahələrlə müqayisə edin nutsqlite (2.0.6-1) [kainat] Pəhriz qidalanma təhlili proqramı nwchem (7.0.0-2) [kainat] Yüksək performanslı hesablama kimya proqramı nwchem-data (7.0.0-2) [kainat] Yüksək performanslı hesablama kimya proqramı (məlumat faylları) oar-common (2.5.8-2) [kainat] OAR toplu planlaşdırıcı ümumi paket avar qovşağı (2.5.8-2) [kainat] OAR toplu planlaşdırıcı node paketi oar-restful-api (2.5.8-2) [kainat] OAR veb xidmətləri oar-server (2.5.8-2) [kainat] OAR toplu planlaşdırıcı server paketi oar-server-mysql (2.5.8-2) [kainat] OAR toplu planlaşdırıcısı MySQL server backend paketi oar-server-pgsql (2.5.8-2) [kainat] OAR toplu planlaşdırıcısı PostgreSQL server backend paketi oar-user (2.5.8-2) [kainat] OAR toplu planlaşdırıcı istifadəçi paketi oar-user-mysql (2.5.8-2) [kainat] OAR toplu planlaşdırıcısı MySQL istifadəçi arxa plan paketi oar-user-pgsql (2.5.8-2) [kainat] OAR toplu planlaşdırıcısı PostgreSQL istifadəçi backend paketi oar-web-status (2.5.8-2) [kainat] OAR toplu planlaşdırıcı vizuallaşdırma alət paketi occt-draw (7.3.3+dfsg1-1build1) [kainat] Açıq CASCADE Texnologiyası əmr tərcüməçisi və qrafik test sistemi oce-draw (0.18.3-1build1) [kainat] OpenCASCADE Community Edition CAE platforması paylaşılan kitabxana oktava-bart (0.5.00-1) [kainat] BART oktava-gdf (0.1.3-3ubuntu2) üçün oktava bağlamaları [kainat] GDF üçün IO kitabxanası -- Oktava interfeysi oktava-psychtoolbox-3 (3.0.16.20200130.dfsg1-1) [kainat] görmə tədqiqatı üçün alətlər qutusu -- Octave bindings octomap-tools (1.9.3+dfsg-2) [kainat] Octovis (1.9.3+dfsg-2) 3D yaşayış şəbəkəsinin xəritələşdirilməsi üçün alətlər [kainat] OctoMap üçün vizual alət (0.11.0-1build1) [kainat] DICOM standart (tətbiq) odin (2.0.3-2build1) üçün C++11 kitabxanası [kainat] maqnit rezonans ardıcıllığını inkişaf etdirin, simulyasiya edin və işlədin ogdi-bin (4.1.0+ds-1build1) [kainat] Açıq Coğrafi Məlumat Anbarı İnterfeys Kitabxanası -- utilitlər ompl-demolar (1.4.2+ds1-5) [kainat] Open Motion Planning Library (OMPL) ompl-plannerarena demoları (1.4.2+ds1-5) [kainat] Open Motion Planning Library (OMPL) plannerarena openbabel (3.0.0+dfsg-3ubuntu3) [kainat] Kimyəvi alətlər qutusu yardım proqramları (cli) openbabel-gui (3.0.0+dfsg-3ubuntu3) [kainat] Kimyəvi alətlər qutusu yardım proqramları (qrafik istifadəçi interfeysi) opencaster (3.2.2+dfsg-1.1build2) [kainat] MPEG2 nəqliyyat axını məlumat generatoru və açıq köpük paket manipulyatoru (1906.191111+dfsg1-2build1) [kainat] Computational Fluid Dynamics (CFD) üçün açıq mənbə alətlər qutusu - binaries openfoam-examples (1906.191111+dfsg1-2build1) [kainat] Hesablama Mayeləri Dinamiği (CFD) üçün açıq mənbə alətlər qutusu - misallar openmolcas (19.11-1build1) [kainat] Kvant kimyası proqram paketi openmolcas-data (19.11-1build1) [kainat] Kvant kimyası proqram paketi (məlumat faylları) openms (2.4.0-real-1ubuntu4) [kainat] LC/MS məlumatların idarə edilməsi və təhlili paketi openms-common (2.4.0-real-1ubuntu4) [kainat] LC/MS məlumatların idarə edilməsi və təhlili üçün paket - paylaşılan data openmx (3.8.5+dfsg1-1build1) [kainat] nanoölçülü material simulyasiyaları üçün paket openmx-data (3.8.5+dfsg1-1build1) [kainat] nanoölçülü material simulyasiyaları üçün paket (məlumatlar) openrocket (15.03.5) [kainat] Model Rocket Simulator openturns-nümunələr (1.14-1ubuntu3) [kainat] OpenTURNS funksionallıqlarının openuniverse nümunələri (1.0beta3.1+dfsg-6build1) [kainat] 3D Kainat Simulyatoru açıq kainat-ümumi (1.0beta3.1+dfsg-6build1) [kainat] 3D Universe Simulator məlumat faylları optgeo (2.25-1) [kainat] həndəsi optika üçün simulyator opticalraytracer (9.6-1) [kainat] Virtual obyektiv/güzgü dizayn emalatxanasının optimallaşdırılması (1.0-2) [kainat] miRNA uyğunlaşdırılması origami-də genetik variasiyaların inteqrasiyası (1.2.7+really0.7.4-1.1) [kainat] Folding @ Home clients orthanc (1.5.8+dfsg-2ubuntu6) üçün komanda xətti idarəetmə aləti [kainat] Tibbi görüntüləmə üçün yüngül, RESTful DICOM server orthanc-dicomweb (1.0+dfsg-2ubuntu10) [kainat] WADO və DICOMweb orthanc-imagej (1.2+dfsg-1) dəstəyi ilə Orthanc-ı genişləndirmək üçün plagin [kainat] Orthanc orthanc-mysql-dən şəkilləri idxal etmək üçün ImageJ plaqini (2.0-2ubuntu5) [kainat] MySQL və ya MariaDB-dən Orthanc orthanc-postgresql (3.2-1ubuntu4) üçün verilənlər bazası kimi istifadə etmək üçün plaginlər [kainat] PostgreSQL-dən Orthanc orthanc-webviewer (2.5-2ubuntu4) üçün verilənlər bazası backend kimi istifadə etmək üçün plaginlər [kainat] Orthanc orthanc-wsi (0.6-2ubuntu5) üçün tibbi şəkillərin veb görüntüləyicisi [kainat] Orthanc (rəqəmsal patoloji) oskar üçün tam slayd görüntüləmə dəstəyi (1.1.0-test-3-3build1) [kainat] Açıq Mənbəli CPAP Analiz Hesabatı (OSCAR) ossim nüvəsi (2.9.1-2build1) [kainat] OSSIM əsas yardım proqramları otb-bin (7.0.0+dfsg-2build3) [kainat] ORFEO Toolbox komanda xətti proqramları otb-bin-qt (7.0.0+dfsg-2build3) [kainat] ORFEO Toolbox qrafik istifadəçi interfeysi proqramları otb-testdriver (7.0.0+dfsg-2build3) [kainat] ORFEO Toolbox kitabxanası - OTBTestDriver otf-trace (1.12.5+dfsg-6build1) [kainat] Açıq Trace Format dəstək kitabxanası - inkişaf faylları packmol (20.010-1build1) [kainat] Molecular Dynamics Simulations paje.app (1.98-1build7) üçün ilkin konfiqurasiyalar [kainat] ümumi vizuallaşdırma aləti (Gantt chart və daha çox) pal2nal (14.1-2) [kainat] zülalları genomik DNT düzülüşünə çevirir paml (4.9j+dfsg-1) [kainat] Maksimum Ehtimal (PAML) ilə Filogenetik Analiz (9-2build1) [kainat] Parafly genomik və transkriptomik xüsusiyyətlərin parametrik qruplaşdırılması (0.0.2013.01.21-4build1) [kainat] OpenMP paraview (5.7.0-4ubuntu9) istifadə edərək paralel əmr emalı [kainat] Paralel Vizuallaşdırma Tətbiqi parsinsert (1.04-5) [kainat] Parsimonious Təsnifat edilməmiş ardıcıllıqların filogenetik ağaclara daxil edilməsi parsinsert-testdata (1.04-5) [kainat] Parsinsert parsnp (1.2.1+dfsg-1build1) üçün test datası [kainat] sürətli nüvə genomu çox düzənli patman (1.2.2+dfsg-6build1) [kainat] qısa ardıcıllığın böyük verilənlər bazası pəncəsinə sürətli uyğunlaşdırılması (1:2.14.04.dfsg.2-9.1build4) [kainat] Physics Analysis Workstation - qrafik analiz proqramı paw++ (1:2.14.04.dfsg.2-9.1build4) [kainat] Physics Analysis Workstation (Lesstif təkmilləşdirilmiş versiya) paw-common (1:2.14.04.dfsg.2-9.1build4) [kainat] Physics Analysis Workstation (ümumi fayllar) pəncə demoları (1:2.14.04.dfsg.2-9.1build4) [kainat] Physics Analysis Workstation nümunələri və testləri pbbamtools (1.0.6+dfsg-2build1) [kainat] Pacific Biosciences binar alignment/xəritə fayllarının işlənməsi pbdagcon (0.3+git20180411.c14c422+dfsg-1build1) [kainat] yönəldilmiş asiklik qrafiklərdən istifadə edərək ardıcıl konsensus pbhoney (15.8.24+dfsg-4) [kainat] genomik struktur variasiya kəşfi pbjelly (15.8.24+dfsg-4) [kainat] genom montajını təkmilləşdirmə aləti pbsim (1.0.3+git20180330.e014b1d+dfsg-1build1) [kainat] PacBio ardıcıllığı üçün simulyator perlprimeri oxuyur (1.2.4-1) [kainat] PCR üçün primerlərin qrafik dizaynı perlprimer-doc (1.2.4-1) [kainat] Perlprimer perm üçün təlimat (0.4.0-4build1) [kainat] dövri aralı toxum pftools (3+dfsg-3) ilə qısa oxunuşların səmərəli xəritələşdirilməsi [kainat] zülal və DNT ümumiləşdirilmiş profilləri qurun və axtarın (1.5+dfsg-1) [kainat] fəza/zaman modelləri ilə filogenetik analiz phipack (0.0.20160614-3build1) [kainat] PHI testi və rekombinasiya fibinin digər testləri (0.3-3build3) [kainat] topologiya phylip (1:3.697+dfsg-1) ilə newick ağaclarının birləşdirilməsi/klasterləşdirilməsi [kainat] filogeniyaların çıxarılması üçün proqramlar paketi phylip-doc (1:3.697+dfsg-1) [kainat] filogeniyaları (sənədləşdirmə) phylonium (1.2-1build1) çıxarmaq üçün proqramlar paketi [kainat] Təkamül məsafələrinin sürətli və dəqiq qiymətləndirilməsi phyml (3:3.3.20190909-1) [kainat] Maksimum Ehtimal fizampından istifadə edərək filogenetik qiymətləndirmə (1.1.0-1build1) [kainat] filogeniya fitilliyinə uyğun gələn nümunə ardıcıllığı (2.7.3+dfsg-2) [kainat] həm filogenetik ağaclar, həm də məlumat matrisləri üzrə sadə təhlillər və ya modifikasiyalar phyx (1.01+ds-1build1) [kainat] Ağaclar və ardıcıllıqlar üzrə UNIX tipli filogenetik analizlər picard-tools (2.18.25+dfsg-2) [kainat] SAM və BAM fayllarını manipulyasiya etmək üçün komanda xətti alətləri picosat (965-1) [kainat] Sübut və əsas dəstək paylayıcısı olan SAT həlledicisi (0

20140707-2build1) [kainat] genomik təkrar analiz pilercr (1.06+dfsg-2build1) [kainat] CRISPR təkrar pilonu tapmaq üçün proqram (1.23+dfsg-1) [kainat] avtomatlaşdırılmış genom montajının təkmilləşdirilməsi və variant aşkarlama aləti pirləri (2.0.2+dfsg-8build1) [kainat] Profilə əsaslanan Illumina cüt sonu Oxunma Simulyatoru pirs nümunələri (2.0.2+dfsg-8build1) [kainat] profil basd Illumina pair-end Reads Simulator (nümunə data) pirs-profillər (2.0.2+dfsg-8build1) [kainat] profile basd Illumina pair-end Reads Simulator (profil məlumatları) pkg-r-autopkgtest (20200104) [kainat] R paketlərinin avtomatik sınaqdan keçirilməsi üçün skript pktools (2.6.7.6+ds-2build2) [kainat] Faydalı raster emal placnetini yerinə yetirmək üçün GDAL əlavə alətləri (1.03-3) [kainat] Plasmid Constellation Network layihə planetləri (0.1.13-20) [kainat] Planet cisimlərinin qravitasiya simulyasiyası plasmidseeker (1.0+dfsg-1) [kainat] bütün genom ardıcıllığından məlum plazmidlərin identifikasiyası plast oxuyur (2.3.2+dfsg-1build1) [kainat] Paralel Yerli Ardıcıllığın Hizalanması Axtarış Aləti plast-məsələn (2.3.2+dfsg-1build1) [kainat] Paralel Yerli Ardıcıllıq Alignment Axtarış Aləti (nümunə data) plastimatch (1.8.0+dfsg.1-2build1) [kainat] tibbi təsvirin yenidən qurulması və qeydiyyatı plink (1.07+dfsg-3build1) [kainat] tam genom assosiasiya analizi alətləri dəsti plink1.9 (1.90

b6.16-200217-1) [kainat] tam genom assosiasiya analizi alətləri dəsti plink2 (2.00

a3-200217+dfsg-1) [kainat] tam genom assosiasiya analizi alətləri dəsti pluto-jpl-eph (0.0

git20180228-1.1build1) [kainat] JPL ephemeres data pluto-ay (0,0

git20180825.e34c1d1-1build1) [kainat] günəş sistemindəki mövqelərin proqnozlaşdırılması üçün rutinlər pnetcdf-bin (1.12.1-1ubuntu2) [kainat] Paralel NetCDF fayllarını oxumaq və yazmaq üçün proqramlar poa (2.0+20060928-7) [kainat] Çox ardıcıl düzülmə populyasiyaları üçün Qismən Sifariş Alignment (1.2.33+svn0120106+dfsg-3build1) [kainat] populyasiya genetik proqram porechop (0.2.4+dfsg-1build2) [kainat] Oxford Nanopore üçün adapter trimmer poretools oxuyur (0.6.0+dfsg-4) [kainat] nanopore nukleotid ardıcıllığı verilənləri üçün alətlər dəsti poretools-data (0.6.0+dfsg-4) [kainat] nanopore nukleotid ardıcıllığı məlumatları üçün alətlər dəsti -- nümunə verilənlər dəstləri pp-popularity-comtest (1.0.6-4build1) [kainat] PredictProtein populyarlıq müsabiqəsi (6.1.09-1build1) [kainat] nitqin analizi və sintezi üçün proqram (0.0.170427+dfsg-2build1) [kainat] DNT, kodon və amin turşusu ardıcıllığı üçün ehtimal uyğunlaşdırma dəsti (1.0.20-6) [kainat] zülal nüvə lokalizasiya siqnallarının proqnozu və təhlili prime-phylo (1.0.11-8build1) [kainat] növ ağacını nəzərə alaraq gen ağaclarının bayesian qiymətləndirilməsi primer3 (2.4.0-2) [kainat] DNT gücləndirici primer3-nümunələr (2.4.0-2) üçün yan oliqo nukleotidlərin dizaynı üçün alət [kainat] DNT amplifikasiyası (nümunələr) proalign (0,603-4) üçün yan oliqo nukleotidlərin dizaynı üçün alətkainat] Ehtimallı çoxlu uyğunlaşdırma proqramı ehtimalı (0.5.0+dfsg-3build1) [kainat] Genom-Geniş Assosiasiya Analizi ehtimal nümunələri üçün alətlər dəsti (0.5.0+dfsg-3build1) [kainat] ProbABEL probalign (1.4-8build1) üçün nümunə faylları [kainat] bölmə funksiyasından istifadə edərək çoxlu ardıcıllığın düzülməsi posterior ehtimallar probcons (1.12-12build1) [kainat] Ehtimal ardıcıllığına əsaslanan çoxlu ardıcıllıqla düzülmə probcons-əlavə (1.12-12build1) [kainat] Probcons paketindən əlavə proqramlar (1.0-12build1) [kainat] zülal ardıcıllığının çoxlu düzülməsi (1:2.6.3-4) [kainat] Mikrob (bakterial və arxeal) gen tapma proqramı profbval (1.0.22-6) [kainat] ardıcıllıq profisisindən çevik/sərt zülal qalıqlarının proqnozlaşdırıcısı (1.0.11-5) [kainat] profnet-bval (1.0.22-6build1) ardıcıllığından zülal-zülal qarşılıqlı təsir sahələrinin proqnozlaşdırılması [kainat] profbval profnet-chop (1.0.22-6build1) üçün neyron şəbəkə arxitekturası [kainat] profchop profnet-con (1.0.22-6build1) üçün neyron şəbəkə arxitekturası [kainat] profcon profnet-isis (1.0.22-6build1) üçün neyron şəbəkə arxitekturası [kainat] profisis profnet-md (1.0.22-6build1) üçün neyron şəbəkə arxitekturası [kainat] metabozukluğu profnet-norsnet (1.0.22-6build1) üçün neyron şəbəkə arxitekturası [kainat] norsnet profnet-prof (1.0.22-6build1) üçün neyron şəbəkə arxitekturası [kainat] profacc profnet-snapfun (1.0.22-6build1) üçün neyron şəbəkə arxitekturası [kainat] snapfun profphd-net (1.0.22-6build1) üçün neyron şəbəkə arxitekturası [kainat] profphd profphd-utils (1.0.10-5build1) üçün neyron şəbəkə arxitekturası [kainat] profphd köməkçi utilitləri convert_seq və filter_hssp proftmb (1.1.12-8build1) [kainat] bakterial transmembran beta barellərin hər qalıq proqnozu progressivemauve (1.2.0+4713+dfsg-4build1) [kainat] çoxlu genom uyğunlaşdırma alqoritmləri proj-bin (6.3.1-1) [kainat] Kartoqrafik proyeksiya kitabxanası (alətlər) proj-rdnap (2008+2018-4) [multiverse] PROJ prokka (1.14.5+dfsg-2) üçün RDNAP şəbəkə korreksiyası faylları [kainat] prokaryotik genomların sürətli annotasiyası prooftree (0.13-1build9) [kainat] Proof General proteinortho (6.0.14+dfsg-1) üçün sübut ağacı vizuallaşdırması [kainat] Geniş miqyaslı protein analizi etirazında (Co-)ortholoqların aşkarlanması (3.4.2+dfsg-3) [kainat] protein təkamülünün ən uyğun modellərinin seçimi pscan-chip (1.1-2build1) [kainat] TF bağlama saytlarının ChIP əsaslı identifikasiyası pscan-chip-data (1.1-2build1) [kainat] PScan-ChIP pscan-tfbs (1.2.2-3build1) üçün köməkçi məlumatlar [kainat] transkripsiya faktorunu birləşdirən saytları axtarın psfex (3.17.1+dfsg-5build2) [kainat] Point Spread Function model çıxarıcı psi3 (3.4.0-6ubuntu1) [kainat] Quantum Chemical Program Suite psi4 (1:1.3.2-3build2) [kainat] Quantum Chemical Program Suite psi4-data (1:1.3.2-3build2) [kainat] Quantum Chemical Program Suite (məlumat faylları) psortb (3.0.6+dfsg-2) [kainat] bakterial lokalizasiyanın proqnozlaşdırılması vasitəsi psixopiyası (2020.1.3+dfsg-2) [kainat] Python psychtoolbox-3-common-da psixoloji stimulların yaradılması üçün mühit (3.0.16.20200130.dfsg1-1) [kainat] görmə tədqiqatı üçün alətlər qutusu -- arch/interpreter müstəqil hissəsi psychtoolbox-3-lib (3.0.16.20200130.dfsg1-1) [kainat] görmə tədqiqatı üçün alətlər qutusu -- arx-spesifik hissələrin təmizlənməsi (2.0.0-4build4) [kainat] Radio interferometrik görüntüləmə pyfai üçün rutinlər toplusu (0.19.0+dfsg1-1build1) [kainat] Sürətli Azimutal İnteqrasiya skriptləri pyfr (1.5.0-3) [kainat] Python pylang-da axının yenidən qurulması (0.0.4-0ubuntu3) [kainat] yaradılan təsadüfi sözlərlə tam sağ cümlə. pymca (5.5.4+dfsg-1build1) [kainat] X-ray flüoresan analizi üçün proqramlar və alətlər dəsti -- skriptlər pymca-data (5.5.4+dfsg-1build1) [kainat] PyMca pymoctool (0.5.0-4) üçün arxitekturadan müstəqil məlumat faylları [kainat] Virtual Rəsədxana pymol (2.3.0+dfsg-1build1) üçün Python Çox Sifarişli Əhatə xəritələri aləti [kainat] Molekulyar Qrafika Sistemi pymol-data (2.3.0+dfsg-1build1) [kainat] PyMOL pythia8-data (8.1.86-1.2build1) üçün məlumat faylları [kainat] PYTHIA8 məlumat faylları python-drizzle-testdata (1.13.1-2build2) [kainat] Python üçün dithered image birləşməsi (Test data) python-escript-doc (5.5-5) [kainat] Escript/Finley python-nifti üçün sənədlər (0.20100607.1-4.1build1) [kainat] NIfTI I/O kitabxanalarına Python interfeysi python-pyode (1.2.0-4+cvs20090320.3build2) [kainat] The Open Dynamics Engine üçün Python bağlamaları python3-airr (1.2.1-2) [kainat] Məlumat Nümayəndəliyi Antikor və TCR ardıcıllıqları üçün standart kitabxana python3-alignlib (0.1.1+dfsg-1ubuntu2) [kainat] python3-amp (0.6.1-1build2) bioloji ardıcıllıqlar üçün redaktə və Hamming məsafələri [kainat] Atomistik Maşın Öyrənmə Paketi (python 3) python3-escript (5.5-5) [kainat] Escript/Finley sonlu elementlər Python3 sistemi (OpenMP ilə) python3-escript-mpi (5.5-5) [kainat] Escript/Finley sonlu elementlər Python3 sistemi (OpenMP + MPI) python3-gfapy (1.0.0+dfsg-4build1) [kainat] ardıcıl qrafikləri idarə etmək üçün çevik və genişləndirilə bilən proqram kitabxanası python3-gffutils (0.10.1-2) [kainat] GFF və GTF faylları ilə çevik verilənlər bazası çərçivəsi ilə işləyin python3-jupyter-sphinx (0.2.3-1) [kainat] Jupyter Sphinx Extension - Python3 python3-louvain (0.0+20181013git3fc1f575-1ubuntu1) [kainat] Louvain metodu python3-morse-simulyatorunu həyata keçirən icma qrafik analizi (1.4-6build1) [kainat] Multi-OpenRobot Simulation Engine python3-noise (1.2.3-3) [kainat] Şəkil yaratmaq üçün Perlin səs-küyü python3-py2bit (0.3.0-3build1) [kainat] 2 bitlik fayllara giriş python3-pybel (0.12.1-1) [kainat] Bioloji İfadə Dili python3-pybigwig (0.3.17-1build2) [kainat] bigBed və bigWig fayllarına sürətli çıxış üçün Python 3 modulu python3-pynlpl (1.2.9-1) [kainat] PyNLPl Təbii Dil Emalı üçün kitabxanadır (Python 3 versiyası) python3-tinyalign (0.2-3) [kainat] sətirlər arasındakı fərqlərin ədədi təsviri pyzo (4.4.3-1.2) [kainat] elmi Python q2 şablonları üçün interaktiv redaktor (2019.10.0+dfsg-1) [kainat] QIIME 2 Plugins qcumber (1.0.14+dfsg-1) üçün dizayn şablon paketi [kainat] genomik ardıcıllıqların keyfiyyətinə nəzarət qfits-tools (6.2.0-8ubuntu2) [kainat] FITS manipulyasiya alətləri qfitsview (4.0+dfsg-2build1) [kainat] DPUSER qgis (3.10.4+dfsg-1ubuntu2) əsasında FITS fayl görüntüləyicisi [kainat] Coğrafi İnformasiya Sistemi (GIS) qgis-api-doc (3.10.4+dfsg-1ubuntu2) [kainat] QGIS API sənədləri qgis-common (3.10.4+dfsg-1ubuntu2) [kainat] QGIS - memarlıqdan asılı olmayan məlumatlar qgis-plugin-grass (3.10.4+dfsg-1ubuntu2) [kainat] QGIS qgis-plugin-grass-common üçün GRASS plagini (3.10.4+dfsg-1ubuntu2) [kainat] QGIS üçün GRASS plagini - memarlıqdan asılı olmayan verilənlər qgis-provayder-grass (3.10.4+dfsg-1ubuntu2) [kainat] QGIS qgis provayderləri üçün GRASS provayderi (3.10.4+dfsg-1ubuntu2) [kainat] QGIS qgis-provayder-ümumi (3.10.4+dfsg-1ubuntu2) üçün məlumat təminatçılarının toplanması [kainat] QGIS-ə məlumat provayderlərinin toplanması - arxitekturadan asılı olmayan fayllar qgis-server (3.10.4+dfsg-1ubuntu2) [kainat] Müxtəlif OGC xidmətlərini təmin edən QGIS server qgis3-survex-import (1.2-1) [kainat] Qmapshack (1.14.0-1build2) mağara tədqiqatı üçün survex 3D fayllarını oxumaq üçün QGIS3 plaqini [kainat] GPS xəritəsi (GeoTiff və vektor) və GPSr idarəetmə qmc (0.94-3.1build1) [kainat] Quine McClusky Sadələşdirmə Aləti qnifti2dicom (0.4.11-1.1build1) [kainat] 3D tibbi təsvirləri DICOM 2D seriyasına çevirin (gui) qrisk2 (0.1.20150729-4) [kainat] ürək-damar xəstəliyi risk kalkulyatoru qthid-fcd-nəzarətçi (4.1-5build1) [kainat] Funcube Dongle nəzarətçi qtltools (1.2+dfsg-2build1) [kainat] Molekulyar QTL kəşfi və kvant-espresso analizi üçün alət dəsti (6.4.1-1build2) [kainat] Elektron Struktur və Ab-Initio Molecular Dynamics Suite kvant-espresso-məlumatları (6.4.1-1build2) [kainat] Elektron Struktur və Ab-Initio Molecular Dynamics Suite (Sənədləşdirmə) kvorumu (1.1.1-2build1) [kainat] Qutemol genom ardıcıllığının Keyfiyyət üçün optimallaşdırılmış oxunuşu (0.4.1)

cvs20081111-13build1) [kainat] makromolekulların interaktiv vizuallaşdırılması r-cran-colorspace (1.4-1+dfsg-1) [kainat] GNU R Rəng Məkanının Manipulyasiyası r-cran-epibasix (1.5-1) [kainat] GNU R Elementar Epidemioloji Funksiyalar r-cran-genetik (1.3.8.1.2-1) [kainat] Populyasiya genetikası üçün GNU R paketi r-cran-haplo.stats (1.7.9-4) [kainat] Haplotip analizi üçün GNU R paketi r-cran-maptools (1:0.9-9+dfsg-1) [kainat] GNU R Məkan obyektlərini oxumaq və idarə etmək üçün alətlər r-cran-msm (1.6.8-1) [kainat] GNU R Çox dövlətli Markov və gizli Markov modelləri fasiləsiz zamanda r-cran-randomforest (4.6-14-2) [kainat] Təsadüfi meşə təsnifatçısı r-cran-sdmtools (1.1-221.2-1) tətbiq edən GNU R paketi [kainat] Növlərin Paylanması Modelləşdirmə Alətləri r-cran-sp (1:1.4-0-1) [kainat] GNU R sinifləri və məkan məlumatları üçün üsullar r-cran-spc (1:0.6.3-1) [kainat] GNU R Statistik Prosesə Nəzarət r-cran-nəzarət (1.17.3-1build1) [multiverse] Epidemik Hadisələrin Modelləşdirilməsi və Monitorinqi üçün GNU R paketi r-cran-vcd (1:1.4-5-1) [kainat] GNU R Kateqorik məlumatların vizuallaşdırılması r-cran-xtable (1:1.8-4-1) [kainat] GNU R məlumatları LaTeX və HTML cədvəllərinə racon (1.4.10-1build1) üçün məcbur edir [kainat] uzun düzəldilməmiş oxunuşların xam de novo DNT montajı üçün konsensus modulu (2.7.1+dfsg-1) [kainat] böyüdülə bilən pasta diaqramları ilə iyerarxik metagenomik məlumatları araşdırın (2.2+ds-1build2) [kainat] Referans-Assisted Genom Ordering Utility ragout-nümunələr (2.2+ds-1build2) [kainat] Referans-Assisted Genom Ordering Utility (nümunə data) rambo-k (1.21+dfsg-3) [kainat] K-mers rampler (1.1.1-1build1) əsasında Təyinat Metodunu oxuyun [kainat] genomik ardıcıllıqların rapmap nümunəsi üçün modul (0.15.0+dfsg-1) [kainat] kvazi-mapping rapmap-dev (0.15.0+dfsg-1) vasitəsilə sürətli həssas və dəqiq DNT oxuma xəritəsikainat] rapmap - sürətli həssas və dəqiq DNT oxunması xəritəsi (bəzi başlıqlar) rapmap-example-data (0.15.0+dfsg-1) [kainat] rapmap üçün nümunə data - sürətli həssas və dəqiq DNT oxunması xəritəol (2.7.6.0-1build1) [kainat] bioloji makromolekulların vizuallaşdırılması rasmol-doc (2.7.6.0-1build1) [kainat] rasmol raster3d (3.0-4-1build1) üçün sənədlər [multiverse] zülalların və ya digər molekulların təsvirlərini yaratmaq üçün alətlər rate4site (3.0.0-6build1) [kainat] konservləşdirilmiş amin turşusu sahələrinin detektoru rawtran (1.1-1build1) [kainat] RAW fotodan FITS çeviricisinə raxml (8.2.12+dfsg-4) [kainat] Filogenetik ağacların şüalarının təsadüfi oxlu maksimum ehtimalı (2.3.1-7build1) [kainat] növbəti nəsil ardıcıllıq məlumatlarının de novo genom birləşmələri ray-extra (2.3.1-7build1) [kainat] Ray rdkit-data (201909.1-2ubuntu5) üçün sonrakı emal üçün skriptlər və XSL vərəqləri [kainat] Kimyaformatika və maşın öyrənmə proqramları toplusu (məlumat faylları) rdp-klassifikatoru (2.10.2-4) [kainat] göbələk lsu, bakterial və archaeal 16s readseq (1-13) üçün genişləndirilə bilən ardıcıllıq təsnifatı [kainat] Ardıcıllıq formatları arasında çevrilmə reapr (1.0.18+dfsg-5build1) [kainat] genom montajının qiymətləndirilməsi üçün universal alət refmac-lüğət (5.41-1) [kainat] makromolekulyar zərifləşdirmə və modelin qurulması üçün lüğət (1.4+dfsg-4) [kainat] krio-elektron mikroskopunda 3D rekonstruksiya üçün alət dəsti relion-bin+gui (1.4+dfsg-4) [kainat] krio-elektron mikroskopunda 3D rekonstruksiya üçün paralel alətlər dəsti relion-bin+mpi (1.4+dfsg-4) [kainat] krio-elektron mikroskopunda 3D rekonstruksiya üçün paralel alət dəsti relion-bin+mpi+gui (1.4+dfsg-4) [kainat] krioelektron mikroskopda 3D rekonstruksiya üçün paralel alətlər dəsti təkrar masker-recon (1.08-4) [kainat] bioloji ardıcıllıqlardan təkrar ailələri tapır reprof (1.0.1-7) [kainat] zülalın ikincili strukturu və əlçatanlıq proqnozlaşdırıcısı (3.2-1) [kainat] əldə edilmiş antimikrobiyal müqavimət genlərinin müəyyən edilməsi resfinder-db (0.0+git20191001.149209d-1) [kainat] ResFinder verilənlər bazası əldə edilmiş müqavimət genlərinin seçilmiş verilənlər bazasıdır resfinder-məsələn (3.2-1) [kainat] əldə edilmiş antimikrob müqavimət genlərini müəyyən edin (nümunə məlumat) rna-ulduz (2.7.3a+dfsg-1build2) [kainat] ultra sürətli universal RNT seq düzləşdirici rnahybrid (2.1.2-5) [kainat] MikroRNT/hədəf duplekslərin sürətli və effektiv proqnozlaşdırılması (3.13.0+dfsg-1) [kainat] yüksək sürətli tək başına pan genom boru kəməri rocs (4:19.12.3-0ubuntu1) [kainat] qrafik nəzəriyyəsi IDE roguenarok (1.0-3) [kainat] saxta takson identifikasiyası üçün çox yönlü və genişlənə bilən alqoritm rsem (1.3.3+dfsg-1) [kainat] Gözləmə-Maksimallaşdırma rtax ilə RNT-Seq (0.984-6) [kainat] 16S ribosomal RNT geninin ruby-getspg (1.14.1-5build2) ardıcıllığının təsnifatı [kainat] Kristal simmetriyasının təyini üçün C kitabxanası - Ruby bağları ruby-rgfa (1.3.1+dfsg-1) [kainat] Ruby runcircos-gui-də GFA format qrafiklərini təhlil edin, redaktə edin və yazın (0.0+git20180828.97703b9-1build1) [kainat] Circos sac2mseed (1.12+ds1-3) işlətmək üçün GUI aləti [kainat] SAC dalğa forması məlumatlarını MiniSEED dastanına çevirin (7.3.0+dfsg-3build5) [kainat] Avtomatlaşdırılmış Geoscientific Analizlər Sistemi saga-common (7.3.0+dfsg-3build5) [kainat] SAGA GIS memarlığı müstəqil fayllar müqəddəs (2.5.0+dfsg-3) [kainat] INTeractome salmidin əhəmiyyətinin təhlili (0.1.23-1) [kainat] Qızıl balıq ardıcıllığından sürətli Kmer əsaslı Salmonella identifikatoru (0.12.0+ds1-1) [kainat] RNT seq data samblaster-dən pis-sürətli transkript kəmiyyəti (0.1.24-2build1) [kainat] dublikatları qeyd edir, uyğunsuzluğu çıxarır/parçalayır samtools (1.10-3) [kainat] SAM, BAM və CRAM formatlarında ardıcıl düzülmələrin işlənməsi samtools-test (1.10-3) [kainat] samtools paketi saods9 (8.1+repack-1) üçün test faylları [kainat] Astronomiya sasview (5.0.1-1build1) üçün şəkil göstərmə aləti [kainat] Kiçik Bucaqlı Səpilmə Analizi paketi sat4j (2.3.5-0.3) [kainat] Java savi-də SAT həlledicilərinin effektiv kitabxanası (1.5.1-3) [kainat] peyk bürcünün vizuallaşdırılması sbmltoolbox (4.1.0-4) [kainat] oktava və matlab scamp üçün libsbml alətlər qutusu (2.0.4+dfsg-1build2) [kainat] Astrometrik və fotometrik həllərin hesablanması elmlə paylanmış hesablama (1.12ubuntu1) [kainat] Debian Science Distributed Computing paketləri elm-elektrofiziologiya (1.12ubuntu1) [kainat] Elektrofiziologiya elmi-yüksək enerji-fizika üçün Debian Elm paketləri (1.12ubuntu1) [kainat] Debian Science High Energy Physics paketləri elm-highenergy-physics-dev (1.12ubuntu1) [kainat] Debian Science High Energy Physics inkişaf paketləri elm-maşın öyrənmə (1.12ubuntu1) [kainat] Debian Science Machine Learning paketləri elm-nanomiqyaslı-fizika (1.12ubuntu1) [kainat] Debian Science Nanoscale Physics paketləri elm-nanoölçülü-fizika-dev (1.12ubuntu1) [kainat] Debian Elm Nanoölçülü Fizika inkişaf paketləri elm-neyroelm-modelləşdirmə (1.12ubuntu1) [kainat] Sinir sistemlərinin modelləşdirilməsi üçün Debian Elm paketləri elm-fizika-dev (1.12ubuntu1) [kainat] Debian Science Physics-dev paketləri elm-psixofizika (1.12ubuntu1) [kainat] Psixofizika elmi simulyasiyaları üçün Debian Elm paketləri (1.12ubuntu1) [kainat] Debian Elm Simulyasiya paketləri qorxulu (1.6.16-2) [kainat] pangenom-geniş assosiasiya tədqiqatları scram (0.16.2-1build2) [kainat] Ehtimal Risk Analizi Aləti scram-gui (0.16.2-1build2) [kainat] SCRAM GUI front-end scrm (1.7.3-1build1) [kainat] genetik ardıcıllıqların təkamülünün simulyatoru sctk (2.4.10-20151007-1312Z+dfsg2-3) [kainat] nitqin tanınması hesablama alətləri dəsti (0.994+git20141017.20d3cff-2) [kainat] Ardıcıllıq üçün Bayesian adapter trimmeri sdaps oxuyur (1.9.7-0.2ubuntu2) [kainat] kağız əsaslı sorğular ilə məlumat əldə etmək üçün skriptlər sdrangelove (0.0.1.20150707-3build2) [kainat] Osmocom Software Defined Radio seaview (1:4.7-1build2) [multiverse] Ardıcıllığın uyğunlaşdırılması və filogeniya görən üçün çox platformalı interfeys (1.1.4-2build2) [kainat] genomik ardıcıllıq elementi (kmer) zənginləşdirmə analizi segemehl (0.3.4-2build1) [kainat] segyio-bin boşluqları ilə qısa oxunuş xəritəsi (1.8.3-1build2) [kainat] Seysmik emal üçün SEG-Y oxumaq/yazmaq kitabxanası (qabıq yardım proqramları) cümlə parçası (0.1.84-1build1) [kainat] Nəzarət olunmayan mətn tokenizer və detokenizer seq-gen (1.3.4-2) [kainat] nukleotid və ya amin turşusu ardıcıllığının təkamülünü simulyasiya edin seqmagik (0.8.0-1) [kainat] Biopython SeqIO seqprep (1.3.2-5) üçün imagemagick kimi ön hissə [kainat] adapterlərin çıxarılması və/yaxud DNT ardıcıllığının qoşalaşmış oxunuşlarının üst-üstə düşən seqprep-məlumatları ilə birləşdirilməsi (1.3.2-5) [kainat] seqprep üçün nümunə verilənlər toplusu - yalnız seqtk (1.3-1) testi üçün istifadə olunur [kainat] FASTA və ya FASTQ formatlı sekstraktorda ardıcıllıqların işlənməsi üçün sürətli və yüngül alət (2.25.0+ds-2) [kainat] Ad dəyişikliyi üçün dummy keçid paketi sga (0.10.15-5build1) [kainat] shapeit4 (4.1+dfsg-1build1) sətir qrafiklərindən istifadə edən de novo genom assembler [kainat] haplotiplərin (mərhələli) qiymətləndirilməsi üçün sürətli və dəqiq üsul (1.0.1062-1) [kainat] SHELXL sibsim4 (0.20-4) üçün qrafik istifadəçi interfeysi [kainat] ifadə edilmiş RNT sekanslarını DNT şablon oraqında düzləşdirin (1.33+git20150314.f3d6ae3-1) [kainat] keyfiyyətli süzgəcdən (4.0.3b-6) istifadə edərək FASTQ faylları üçün pəncərəli adaptiv kəsmə aləti [multiverse] zülaldakı əvəzetmənin fenotipik effektə malik olub-olmadığını proqnozlaşdırır sigma-align (1.1.3-6) [kainat] Qeyri-kodlaşdırılmayan DNT ardıcıllığının sadə acgöz çoxlu düzülüşü silx (0.12.0+dfsg-1build1) [kainat] X-Ray məlumatlarının təhlili üçün alətlər qutusu - İcra olunanlar sim4 (0.0.20121010-5) [kainat] cDNA və genomik DNT simgrid-java (3.24+dfsg-3) uyğunlaşdırmaq üçün alət [kainat] SimGrid Toolbar simka (1.5.1-4build1) üçün Java bağlamaları [kainat] NGS verilənlər bazasına həsr olunmuş müqayisəli metagenomika metodu simkamin (1.5.1-4build1) [kainat] NGS verilənlər bazasına həsr olunmuş təxmini müqayisəli metagenomika metodu siril (0.9.12-2build3) [kainat] astronomik təsvir emal aləti siril-ümumi (0.9.12-2build3) [kainat] siril skesa (2.3.0-2) üçün arxitekturadan asılı olmayan fayllar [kainat] vicdanlı yığıncaqlar üçün strateji Kmer uzantısı (0.2.2-1build1) [kainat] yüksək məhsuldarlıqlı DNT ardıcıllığının sonrakı emalı skycat (3.1.2+starlink1) oxuyur

b+dfsg-5build3) [kainat] Şəklin vizuallaşdırılması və astronomiya jarqon-xfig (0.2.0) üçün kataloqlara və məlumatlara giriş

.117-2) [kainat] S-Lang smalt-da Xfig's fig2dev vasitəsilə süjetlər və çertyojlar hazırlayın (0.7.6-9) [kainat] Ardıcıl Xəritəçəkmə və Alignment Aləti smalt nümunələri (0.7.6-9) [kainat] Ardıcıl Xəritəçəkmə və Alignment Aləti (nümunələr) smithwaterman (0.0+git20160702.2610e25-7build1) [kainat] iki sətir və ya snakemake genom ardıcıllığı arasında oxşar bölgələri təyin edin (5.10.0-2) [kainat] pythonic iş axını idarəetmə sistemi snap (29-11-2013) [kainat] gizli markov modeli snap-aligner (1.0) ilə DNT ardıcıllığından genlərin yeri

beta.18+dfsg-3build1) [kainat] Ölçəklənən Nukleotid Alignment Proqramı snaphu (2.0.3-1) [multiverse] 2D Faza Açılış Sniffles üçün Statistik-Xərc, Şəbəkə Axını Alqoritmi (1.0.11+ds-1build1) [kainat] üçüncü nəsil sıralama snp-saytlarından istifadə edərək struktur dəyişikliyi çağıran (2.5.1-1) [kainat] snp-sites snpomatic paketi üçün ikili kod (1.0-4build1) [kainat] sürətli, sərt qısa oxunan xəritəçəkmə proqram sabunu (2.20-3) [kainat] soapdenovo növbəti nəsil sekvenserlərinin qısa oxunuşlarının hizalayıcısı (1.05-5) [kainat] de novo layihə montajı soapdenovo2 (241+dfsg-3build1) qurmaq üçün qısa oxunan montaj üsulu [kainat] yeni layihə montaj sabunu qurmaq üçün qısa oxunan montaj üsulu (1.03-3build1) [kainat] genomların konsensus ardıcıllığını birləşdirə bilən resequecing utility solvat (1.0-2) [multiverse] protein strukturları ətrafında su molekullarını təşkil edir solvat-doc (1.0-2) [multiverse] Solvat sortmerna üçün sənədlər (2.1-4build1) [kainat] filtrləmə, xəritəçəkmə və OTU seçmə aləti NGS oxuyur mənbə-çıxarıcı (2.25.0+ds-2) [kainat] Astronomik təsvirlər üçün mənbə çıxarıcı (1.2.0-201605+dfsg-1build1) [kainat] aralı sözlərdən istifadə edərək düzülməsiz ardıcıllığın müqayisəsi (3.13.1+dfsg-2build2) [kainat] tək hüceyrə üçün genom assembler və spaln məlumat dəstlərini təcrid edir (2.4.0+dfsg-2build1) [kainat] genomik DNT spaln-məlumatlarına splicing-aware transkript-alignment (2.4.0+dfsg-2build1) [kainat] genomik DNT (məlumat) spassına splicing-xəbərdar transkript-alignment (3.7-4) [kainat] bərabərlik ilə birinci dərəcəli məntiq üçün avtomatlaşdırılmış teorem sübutu spatialite-bin (4.3.0-3build1) [kainat] SQLite üçün coğrafi genişlənmə - alətlər spd (1.3.0-1ubuntu3) [kainat] Sinxrotron təsviri düzəlişləri və azimutal inteqrasiya sıçrayışı (2.9.1-1ubuntu1) [kainat] Hamarlanmış Hissəcik Hidrodinamika simulyasiyası üçün vizual alət (3.0.1-1build1) [kainat] SIMD qismən düzənləmə aləti spread-phy (1.0.7+dfsg-2) [multiverse] filocoğrafi rekonstruksiyaların təhlili və vizuallaşdırılması (2.0.0

beta2-2) [kainat] Spectrum Viewer squizz (0.99d+dfsg-2) [kainat] Genetik ardıcıllıqlar və düzülmələr üçün çevirici srst2 (0.2.0-7) [kainat] Bakterial Patogenlər üçün Qısa Oxuma Sırasının Yazılması (4.0-3) [kainat] milyonlarla çox qısa DNT ardıcıllığının yığılması üçün genomik proqram ssake-nümunələr (4.0-3) [kainat] qısa oxunan sspace (2.1.1+dfsg-5) genom montajçısı SSAKE üçün nümunə data [kainat] uzadılması ssw-align (1.1-9) sonra iskele əvvəlcədən yığılmış contigs [kainat] libssw yığınlarına əsaslanan Smith-Waterman hizalayıcısı (2.41+dfsg-1build3) [kainat] staden (2.0.0+b11-4build1) qısa oxunan DNT ardıcıllığından lokuslar yaratmaq üçün boru kəməri [kainat] DNT ardıcıllığı montajı (Gap4/Gap5), redaktə və analiz alətləri staden-common (2.0.0+b11-4build1) [kainat] Staden staden-io-lib-examples üçün memarlıq müstəqil fayllar (1.14.11-6) [kainat] DNT ardıcıllığı fayllarının manipulyasiyası üçün proqramlar (istifadə nümunələri) staden-io-lib-utils (1.14.11-6) [kainat] DNT ardıcıllığı fayllarını manipulyasiya etmək üçün proqramlar stardata-common (0.8build1) [kainat] Astronomiya paketlərini idarə etmək üçün ümumi çərçivə (0.95.5-8.3build1) [kainat] 3-ölçülü perspektiv ulduz xəritəsi görüntüləyicisi starpu-töhfə nümunələri (1.3.3+dfsg-1build1) [multiverse] Heterojen çoxnüvəli maşınlar üçün tapşırıq planlayıcısı - exs starpu-examples (1.3.3+dfsg-2build1) [kainat] Heterojen çoxnüvəli maşınlar üçün tapşırıq planlayıcısı - exs stellarium (0.19.3-1build1) [kainat] real vaxt foto-real səma generatoru stellarium-data (0.19.3-1build1) [kainat] Stellarium məlumat faylları sərt (2.4.0-3) [kainat] elmi FITS şəkillərini TIFF formatlı stiltlərə çevirin (3.2-2) [kainat] Starlink Cədvəllər İnfrastruktur Kitabxana Alət Dəsti stimfit (0.16.0-1build2) [kainat] Elektrofizioloji məlumatlara baxmaq və təhlil etmək üçün proqram (2.1.1+ds-2) [kainat] qısa RNAseq oxunuşlarını alt oxunan transkriptlərə yığın (2.0.0+dfsg-1) [kainat] növbəti nəsil ardıcıllıq məlumatlarının subread-datasının işlənməsi üçün alətlər dəsti (2.0.0+dfsg-1) [kainat] subread paket paket adı üçün məlumat faylları (0.3.070628-2) [kainat] RNT onurğası sumaklastındakı hər bir dəstəni kateqoriyalara ayırın (1.0.35-2) [kainat] sumatra genom ardıcıllığının sürətli və dəqiq qruplaşdırılması (1.0.31-2) [kainat] sumo ardıcıllığının sürətli və dəqiq müqayisəsi və qruplaşdırılması (1.4.0+dfsg1-1) [kainat] Şəhər Hərəkətliliyinin Simulyasiyası (SUMO) surankco (0.0.r5+dfsg-2) [kainat] De novo Assemblies survex-də Contigs Nəzarət Reytinqde (1.2.42-1build2) [kainat] mağara ölçmə və xəritəçəkmə proqramı survex-aven (1.2.42-1build2) [kainat] Survex sürü üçün mürəkkəb mağara sorğusuna baxıcı (3.0.0+dfsg-2build1) [kainat] amplikon əsaslı tədqiqatlar üçün güclü və sürətli klasterləşdirmə metodu (2.38.0+dfsg-4) [kainat] Yenidən nümunə götürün və birlikdə əlavə edin FITS şəkilləri swarp виртуальный paket, preдоставляемый suckless-tools swe-basic-data (1.80.00.0002-1ubuntu2) [kainat] libswe paketi swe-standard-data (00004-1) üçün əsas məlumat faylları [kainat] Swiss Ephemeris sweed üçün standart məlumatlar (3.2.1+dfsg-1) [kainat] SNP-lərin təkamül üstünlükləri üçün qiymətləndirilməsi (4.3.0-dfsg1-5) [kainat] Mürəkkəb bərk həndəsələrdə keçici istilik simulyasiyaları syrthes-testlər (4.3.0-dfsg1-5) [kainat] SYRTHES syrthes-tools (4.3.0-dfsg1-5) üçün sınaq nümunələri [kainat] Mürəkkəb bərk həndəsələrdə keçici istilik simulyasiyaları - alətlər t-qəhvə (12.00.7fb08c2-4build1) [kainat] Çox Ardıcıllıq Alignment t-qəhvə nümunələri (12.00.7fb08c2-4build1) [kainat] T-Coffee tabix-dən istifadə üçün şərhli nümunələr (1.10.2-3) [kainat] TAB ilə ayrılmış genom mövqe faylları tandem-kütlə üçün ümumi indeksləşdirici (1:201702011-1build1) [kainat] protein identifikasiyası tantan üçün kütləvi spektrometriya proqramı (22-1build1) [kainat] biosequences tcd-utils üçün aşağı mürəkkəblik və tandem təkrar maskalayıcısı (20061127-2build1) [kainat] Tide Constituent Database (TCD) fayllarını çevirin tcl-fitstcl (2.4-4build1) [kainat] FITS fayllarına Tcl interfeysi tcliis (8.1+repack-1) [kainat] Tcl IIS protokol paketi terraintool (1.13-2) [kainat] SRTM və ASTER data therion (5.4.4ds1-5ubuntu1)-dən survex formatlı relyef modellərini yaradır [kainat] Mağara tədqiqatı - 2D və 3D rəsm proqramı therion-doc (5.4.4ds1-5ubuntu1) [kainat] Therion Cave tədqiqat proqramı üçün sənədlər therion-viewer (5.4.4ds1-5ubuntu1) [kainat] Mağara tədqiqatı - therion modelləri üçün 3D görüntüleyici (3.3.0-8) [kainat] makromolekulların üst-üstə düşmə ehtimalı olan bu misallardan istifadə edərək (3.3.0-8) [kainat] maksimum ehtimal (nümunələr) tezislərindən (3.1.1-1) istifadə edərək makromolekulların üst-üstə düşməsi [kainat] Haplotip Effektlərinin Assosiasiya Tədqiqatlarında Test Edilməsi tigr-glimmer (3.02b-2build1) [kainat] Arxe və bakteriyalarda gen aşkarlanması (6.4.13-1build1) [kainat] Tilburg Yaddaş Əsaslı Öyrənən timblserver (1.12-1build1) [kainat] Timbl tksao (8.1+repack-1) üçün server genişləndirmələri [kainat] Astronomik təsvir və məlumatların vizuallaşdırılması üçün Tk vidjetləri tm-align (20190822+dfsg-2build1) [kainat] zülalların struktur uyğunlaşması tnseq-tranzit (3.0.2-1build1) [kainat] genlərin və ya genomik bölgələrin əsaslığının statistik hesablamaları topcat (4.7-2) [kainat] Kataloqlar və Cədvəllər üzərində əməliyyatlar üçün alət (1.4-1) [kainat] TopHat üçün post-prosessor unmapped oxuyur topp (2.4.0-real-1ubuntu4) [kainat] OpenMS Proteomik Boru Kəmərini həyata keçirən proqramlar toplusu (1.10-7) [kainat] transmembran topologiyasının proqnozlaşdırılması toulbar2 (1.0.0+dfsg3-2build1) [kainat] Qrafik Modellər üçün dəqiq kombinatorial optimallaşdırma toulbar2-doc (1.0.0+dfsg3-2build1) [kainat] Qrafik Modellər üçün dəqiq kombinatorial optimallaşdırma - sənədlər trace2dbest (3.0.1-1) [kainat] xromatoqram məlumatlarının toplu şəkildə dbEST trace2dbest-doc-a təqdim edilməsi (3.0.1-1) [kainat] Trace2dbest tracetuner üçün sənədlər və nümunə faylları (3.0.6

beta+dfsg-2build1) [kainat] DNT Sanger sıralama məlumatlarının təfsiri transkalc (0.14-6) [kainat] mikrodalğalı və RF ötürmə xətti kalkulyatoru transdekoder (5.0.1-3) [kainat] RNT transkript ardıcıllığı daxilində kodlaşdırma bölgələrini tapın transrate-tools (1.0.0-2build1) [kainat] transtermhp transrate üçün köməkçi (2.09-4build1) [kainat] travis bakteriya genomlarında rho-müstəqil transkripsiya terminatorlarını tapın (190101-1build1) [kainat] traektoriya analizatoru və vizualizator ağac tapmacası (5.2-11) [kainat] Maksimum ehtimal ağac tapmacası ilə filogenetik ağacların paralel şəkildə yenidən qurulması (5.2-11) [kainat] Filogenetik ağacların maksimum ehtimal ağac-pazl-doc (5.2-11) ilə yenidən qurulması [kainat] Filogenetik ağacların maksimum ehtimalla yenidən qurulması (sənəd) ağac görünüşü (1.1.6.4+dfsg1-4) [multiverse] Michael Eisenin TreeView treeviewx (0.5.1+git20100823.7e4d0e9-2build1) Java yenidən tətbiqi [kainat] Filogenetik ağacları göstərir və çap edir üçbucaq-bin (1.6-2build1) [multiverse] Yüksək keyfiyyətli 2-D mesh generator binar proqramları trim-galore (0.6.5-1) [kainat] DNT ardıcıllığı trimmomatik (0.39+dfsg-1) üçün keyfiyyət və adapter kəsilməsini avtomatlaşdırın [kainat] Illumina NGS data trinityrnaseq (2.6.6+dfsg-6build2) üçün çevik oxu kəsmə aləti [kainat] RNA-Seq De novo Assambleyası trinityrnaseq-nümunələr (2.6.6+dfsg-6build2) [kainat] RNA-Seq De novo Assambleyasının ümumi nümunəsi və sınaq faylları trnascan-se (2.0.5-1) [multiverse] trnascan-se-common (2.0.5-1) genom ardıcıllığında transfer RNT genlərinin aşkarlanması [multiverse] transfer RNT genlərinin genomik ardıcıllıqla aşkarlanması (ümumi fayllar) tunnelx (20170928-2) [kainat] Cave Survey rəsm proqramı tvc (5.0.3+git20151221.80e144e+dfsg-3) [kainat] Ion Torrent sıralama platformaları üçün genetik variant zəngi twms (0.07z-1) [kainat] kiçik veb xəritə xidməti ubertooth (2018.12.R1-4) [kainat] Bluetooth sınaq ubertooth-firmware (2018.12.R1-4) üçün 2.4 GHz simsiz inkişaf platforması [kainat] Ubertooth ubertooth-firmware-source (2018.12.R1-4) üçün proqram təminatı [kainat] Ubertooth proshivka uc-echo (1.12-13) üçün mənbə kodu [kainat] NGS ucto-dan (0.14-2build2) qısa oxunuşlar üçün nəzərdə tutulmuş xətaların düzəldilməsi alqoritmi [kainat] Unicode Tokenizer uctodata (0.8-2) [kainat] Ucto ugene üçün məlumat faylları (34.0+dfsg-1) [multiverse] inteqrasiya olunmuş bioinformatika alət dəsti ugene-data (34.0+dfsg-1) [multiverse] UGENE üçün tələb olunan məlumatlar - inteqrasiya olunmuş bioinformatika alət dəsti uhd-host (3.15.0.0-2build5) [kainat] Ettus Research məhsulları üçün universal hardware driver - host apps unicycler (0.4.8+dfsg-2build1) [kainat] bakterial genomlar üçün hibrid montaj boru kəməri unicycler-data (0.4.8+dfsg-2build1) [kainat] bakterial genomlar üçün hibrid montaj boru kəməri (məlumat paketi) vahidləri-filtr (3.9-1build1) [kainat] Fiziki dəyərlərə aid ifadələr üçün təhlilçi v-sim (3.7.2-8build1) [kainat] Atom strukturlarını görüntüləyin v-sim-ümumi (3.7.2-8build1) [kainat] Atom strukturlarını görüntüləyin (dəstək faylları) v-sim-pluginləri (3.7.2-8build1) [kainat] V_Sim üçün plaginlər (3D vizuallaşdırma paketi) varna (3-93+ds-2) [kainat] RNT varscan üçün vizuallaşdırma appeti (2.4.3+dfsg-3) [multiverse] növbəti nəsil ardıcıllıq verilənləri vcftools-da variant aşkarlanması (0.1.16-1build1) [kainat] VCF faylları ilə işləmək üçün alətlər toplusu vdjtools (1.2.1+git20190311-1) [multiverse] məxmər (1.2.10+dfsg1-7) B/T hüceyrə repertuarlarının sonrakı təhlili üçün çərçivəkainat] Çox qısa oxumaq üçün nuklein turşusu ardıcıllığı montajçısı məxmər-məsələn (1.2.10+dfsg1-7) [kainat] Velvet sequence assembler üçün nümunə data məxmər uzun (1.2.10+dfsg1-7) [kainat] Çox qısa oxumaq üçün nuklein turşusu ardıcıllığı montajçısı, uzun versiya məxmər testləri (1.2.10+dfsg1-7) [kainat] Velvet sequence assembler velvettoptimizer (2.2.6-2) üçün sınaq məlumatları [kainat] Velvet do novo montaj parametrlərini avtomatik optimallaşdırır veusz (3.0.1-1ubuntu4) [kainat] Qrafik interfeys vg (1.22.0+ds-1) ilə 2D və 3D elmi planlama proqramı [kainat] genom variasiya qrafikləri ilə işləmək üçün alətlər vg-docs (1.22.0+ds-1) [kainat] genom variasiya qrafikləri ilə işləmək üçün alətlər -- docs viewmol (2.4.1-26ubuntu1) [kainat] hesablama kimya proqramları üçün qrafik ön hissə virulencefinder (2.0.3+git20190809.dde157a-1) [kainat] bakteriyanın ümumi və ya qismən ardıcıl izolatlarında virulentlik genlərini müəyyənləşdirin virulent tapıcı nümunələri (2.0.3+git20190809.dde157a-1) [kainat] virulencefinder visp-images-data üçün nümunə data (3.3.0-1) [kainat] vizual xidmət kitabxanası - verilənlər bazası istinad faylları vistrails (3.0

git+9dc22bd-2) [kainat] Elm vizuallaşdırma iş axını alət dəsti vmatch (2.3.1+dfsg-6) [kainat] böyük miqyaslı ardıcıllıq təhlili proqramı voro++ (0.4.6+dfsg1-3build1) [kainat] Voronoi diaqramının hesablanması üçün kitabxana voro++-nümunələr (0.4.6+dfsg1-3build1) [kainat] Voronoi diaqramının hesablanması üçün kitabxana (nümunələr) voronota (1.21.2744-1build1) [kainat] Atom kontaktlarını tapmaq üçün Voronoi diaqramına əsaslanan alət votca-csg (1.6

rc1-2build1) [kainat] VOTCA'nın qaba dənəli mühərrik votca-csg-skriptləri (1.6

rc1-2build1) [kainat] VOTCA-nın iri skriptləri votca-csg-dərslikləri (1.6)

rc1-2build1) [kainat] VOTCA'nın qaba dənəli dərslikləri votca-tools (1.6)

rc1-3build1) [kainat] VOTCA'nın alətlər kitabxanası, köməkçi binaries vowpal-wabbit (8.6.1.dfsg1-1build2) [kainat] sürətli və genişlənən onlayn maşın öyrənmə alqoritmi vrrender (19.0.0-5ubuntu4) [kainat] DICOM Viewer vsearch (2.14.1-3build1) [kainat] metagenomik ardıcıllıqların işlənməsi üçün alət wannier90 (3.0.0+ds-4build1) [kainat] Maksimal Lokallaşdırılmış Wannier Funksiyaları - icra olunanlar wannier90-data (3.0.0+ds-4build1) [kainat] Maksimal Lokallaşdırılmış Wannier Funksiyaları - sənədlər və nümunələr wcslib-tools (7.1+ds-2) [kainat] wcslib wcstools istifadə edən komanda xətti alətləri (3.9.5-3) [kainat] FITS şəkil çəkicisinin WCS-ni idarə edin (1.12+dfsg-1) [kainat] Astronomik təsvirin işlənməsi üçün xəritələri və çoxbucaqlı məlumatlarını birləşdirin weka (3.6.14-1) [kainat] Data mining tapşırıqları üçün maşın öyrənmə alqoritmləri wham-align (0.1.5-2build1) [kainat] Wisconsin's High-Throughput Alignment Method wigeon (20101212+dfsg1-3) [kainat] Pintail 16S DNT anomaliyasının aşkarlanması yardım proqramının yenidən tətbiqi (2.4.1-21) [kainat] biopolimerlərin müqayisəsi, DNT və zülal ardıcıllığı wsclean (2.8-1build2) [kainat] Sürətli ümumi geniş sahəli interferometrik görüntüleyici wxastrocapture (1.8.1+git20140821.796e1a1+dfsg-1) [kainat] Windows linuX Astronomy Capture x13as (1.1-B39-1build1) [multiverse] xbs zaman seriyasının modelləşdirilməsi üçün mövsümi tənzimləmə proqramı (0-10build1) [kainat] xcas molekullarının 3 ölçülü modelləri və filmləri (1.5.0.85+dfsg1-3) [kainat] Kompüter Cəbr Sistemi - konsol və qrafik kalkulyator xcrysden (1.6.2-3build1) [kainat] Kristal və Molekulyar Struktur Visualizer xcrysden-data (1.6.2-3build1) [kainat] Kristal və Molekulyar Struktur Visualizer (Məlumat Faylları) xdrawchem (1:1.10.2.1-3build1) [kainat] Kimyəvi strukturlar və reaksiyalar redaktoru xfoil (6.99.dfsg+1-1build1) [kainat] xmakemol (5.16-9) səssiz hava pərdələrinin dizaynı və təhlili üçün proqram.kainat] atom və molekulyar sistemləri vizuallaşdırmaq üçün proqram xmakemol-gl (5.16-9) [kainat] atom və molekulyar sistemləri vizuallaşdırmaq üçün proqram (OpenGL) xpa alətləri (2.1.19-1) [kainat] Unix proqramları xplot (1.19-9build2) arasında qüsursuz əlaqə üçün alətlər [kainat] sadə ekranda x-y sütun data plotter xplot-xplot.org (0.90.7.1-4) [kainat] çoxlu məlumatların qrafiki və vizuallaşdırılması üçün sürətli alət xppaut (6.11b+1.dfsg-1build1) [kainat] Phase Plane Plus Auto: Çox növ tənlikləri həll edir xtide (2.13.2-1build2) [kainat] gelgit və cari proqnozları təmin edir xtide-sahil xətti (20020202-1) [kainat] xtide xtide-data üçün sahil xətti məlumatları (20100529-1) [kainat] xtide xtide-data-nonfree üçün harmonika məlumatları (20100529-1) [multiverse] xtide (Kanada, Hollandiya, Almaniya və Böyük Britaniya) xyscan (4.30-2build2) üçün harmonika məlumatları [kainat] elm adamları üçün məlumat oğrusu yade (2020.01a-6build2) [kainat] Diskret element modelləşdirmə platforması yagv (0.4

20171211.r234ef16+dfsg-1) [kainat] başqa bir G-kod görüntüləyicisi yaha (0.1.83-1build1) [kainat] tək uçlu sorğularda bölünmüş oxunmuş xəritələri tapın yorick-av (0.0.5-1build1) [kainat] Yorick-dən müxtəlif formatlarda filmlər yazın yorick-full (2.2.04+dfsg1+full) [kainat] Yorick tərcüməçisinin və yorick-gy əlavələrinin tam quraşdırılması (0.0.5-1) [kainat] GObject introspeksiyası və Yorick yorick-gyoto üçün Gtk bağlamaları (1.4.4-3) [kainat] Yorik dili yorick-mira (1.1.0+git20170124.3bd1c3) üçün ümumi relativistik geodeziya inteqrasiyası

dfsg1-2) [kainat] Yorick yorick-mpeg daxilində optik interferometriya təsvirinin yenidən qurulması (0.1-3) [kainat] Yorick dili üçün MPEG çıxış dəstəyi yorick-mpy-common (2.2.04+dfsg1-10) [kainat] Mesaj Yorick (ümumi fayllar) Yorick-mpy-mpich2 (2.2.04+dfsg1-10) [kainat] Mesaj Yorick (MPICH2 build) yorick-mpy-openmpi (2.2.04+dfsg1-10) [kainat] Mesaj Yorick (OpenMPI build) yorick-svipc (0.16-5build1) [kainat] Yorick yorick-ygsl (1.2.1-1build1) üçün proseslərarası rabitə (ortaq yaddaş. ) [kainat] Yorick dili yorick-ynfft (1.0.3-1) üçün GSL xüsusi funksiyalar plagini [kainat] Yorick z3 (4.8.7-4build1) üçün boşluqsuz sürətli Furye çevrilməsi [kainat] Microsoft Research z88-dən teorem sübutu (13.0.0+dfsg2-6) [kainat] Sonlu Elementlərin Təhlili Proqramı - iş vaxtı zalign (0.9.1-4build1) [kainat] bioloji ardıcıllıqların paralel lokal uyğunlaşdırılması zegrapher (3.0.2-1build1) [kainat] zimpl (3.3.6-2) müstəvisində riyazi funksiyaların və ardıcıllıqların qrafikinin çəkilməsi [kainat] optimallaşdırma problemləri üçün riyazi modelləşdirmə dili ztex-bmp (20120314-2) [kainat] universal makro prosessor


Williams T, Kelley C, Bröker HB, Campbell J, Cunningham R, Denholm D, Elber G, Fearick R, Grammes C, Hart L, Hecking L, Koenig T, Kotz D, Kubaitis E, Lang R, Lecomte T, Lehmann A , Mai A, Merritt EA, Mikulík P, Steger C, Tkacik T, Van der Woude, Woo A, Van Zandt JR, Zellner J: Gnuplot. [http://www.gnuplot.info/].

Mathworks:Matlab: Texniki hesablama dili. [http://www.mathworks.com/products/matlab/].

Abbott B, Adler A, Aitkenhead AH, Anderson G, Andersson J, Annamalai M, Appel M, Atzeri M, Ayal S, Banks R, Barrowes B, Barth A, Bateman D, Bauschke H, Bect J, Belov R, Berry K , Billinghurst D, Bindner D, Bogusz J, Borgmann M, Boven P, Bovey R, Bradshaw J, Brinkmann M, Brister M, Bruno R, Buchacher C, Burchard A, Caliari M:GNU Octave. [http://www.gnu.org/software/octave].

Harrington B, Hurst N, Gould T, Albert M, Andler J, Bah T, Barbry-Blot P, Barraud JF, Baxter B, Beard J, Bintz J, Biro A, Bishop N, Blocher JL, Böck H, Bohre H, Borgmann D, Bouclet B, Broberg G, Brown C, Breuer H, Brubaker M, Bruno L, Buculei N, Byak B, Caclin P, Caldwell I, Carmichael G, Catmur E, Boldewyn:Inkscape. [http://inkscape.org].

Dantzig GB:Xətti bərabərsizliklərə məruz qalan dəyişənlərin xətti funksiyasının maksimallaşdırılması. İstehsalın və Bölgənin Fəaliyyət Təhlili. Redaktə edən: Koopmans TC. 1951, Nyu-York və London: Wiley və Chapman-Hall, 339-347.

Stroustrup B: C++ Proqramlaşdırma, Dil, 4-cü nəşr. 2013, Upper Saddle River: Addison-Wesley Professional

Doumont J-L: Ağaclar, Xəritələr və Teoremlər: Rasional Ağıllar üçün Effektiv Ünsiyyət. 2009, Kraainem: Principiae

Tufte ER: Vizual, Kəmiyyət məlumatlarının nümayişi, 2-ci nəşr. 2001, Cheshire: Graphics Press


Videoya baxın: Why Linus Torvalds doesnt use Ubuntu or Debian (Iyul 2022).


Şərhlər:

  1. Amadeo

    Əlbəttə. Bu mənimlə idi. Bu sualı müzakirə edək.

  2. Hamadi

    Bu cümlə, heyrətamiz))), xoşuma gəlir :)

  3. Theomund

    Urrrah! Kütlələrə yeni kəşflər. Onların ardıcıllığı əbədi və əbədi olaraq atəş etməsinlər.

  4. Balkis

    Bir tanrıya məlumdur!

  5. Mokinos

    Sən düzgün deyilsən. Mən əminəm. Bunu sübut edə bilərəm. PM-də mənə e-poçt göndərin.

  6. Brehus

    Əlbətdə haqlısan. İçində bir şey və əla düşüncədir. Mən səni dəstəkləyirəm.



Mesaj yazmaq